Recombinant Drosophila melanogaster Neuropeptide Y receptor (NepYr)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Information

  • Gene Names:

    • Primary: NepYr

    • Aliases: RYa-R, CG5811, PR4, Dm RYa-R .

  • Protein Names:

    • Neuropeptide Y receptor (NPY-R)

    • RYamide receptor .

  • UniProt ID: P25931 .

  • Host Systems for Production:

    • E. coli, Yeast, Baculovirus, Mammalian Cells, or Cell-Free Expression .

  • Purity: ≥85% (SDS-PAGE) .

Biological Pathways

  • Feeding Regulation:

    • Binds dRYamide-1/2 ligands, suppressing feeding motivation in blowflies .

    • Antagonizes the appetite-stimulating effects of neuropeptide F (NPF) .

  • Courtship Behavior:

    • Modulates male courtship drive through interactions with P1 neurons .

  • Developmental Processes:

    • Regulates ecdysone biosynthesis in the prothoracic gland, impacting larval growth and metamorphosis .

  • Social Behavior:

    • Loss of NepYr signaling induces premature food aversion and cooperative burrowing in larvae .

Key Research Findings

Study FocusYearKey OutcomesSources
Ligand Identification2011dRYamide-1/2 identified as endogenous ligands; suppresses feeding in flies.
Courtship Circuitry2019NepYr neurons interface with P1 courtship decision neurons to regulate sexual drive.
Developmental Signaling2003Npf/NepYr signaling sustains larval foraging and delays social behavior.
Ethanol Sensitivity2005Npf/NepYr system mediates ethanol sedation resistance in Drosophila.

Experimental Uses

  • Antibody Production:

    • Rabbit polyclonal antibodies target NepYr for Western blot (WB) and ELISA .

  • Functional Assays:

    • Calcium imaging and cAMP assays to study receptor activation .

  • Structural Studies:

    • Recombinant protein used for crystallography and ligand-binding analyses .

Evolutionary and Comparative Insights

  • Conservation:

    • Functional parallels with vertebrate NPY receptors in appetite regulation .

    • Similar social behavior modulation observed in C. elegans NPY-like systems .

  • Diversity:

    • Drosophila NEP-like gene family expansion (e.g., Nep2 in renal and reproductive systems) highlights functional specialization .

Challenges and Future Directions

  • Unresolved Questions:

    • Mechanistic links between NepYr signaling and insulin/ecdysone pathways .

    • Role in adult behaviors beyond feeding and courtship (e.g., sleep, memory) .

  • Technical Advancements:

    • CRISPR/Cas9-generated npylr1 mutants enable precise functional studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: Our proteins are standardly shipped with blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
RYa-R; NepYr; CG5811; RYamide receptor; Neuropeptide Y-like receptor; NPY-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-464
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
RYa-R
Target Protein Sequence
MEHHNSHLLPGGSEKMYYIAHQQPMLRNEDDNYQEGYFIRPDPASLIYNTTALPADDEGS NYGYGSTTTLSGLQFETYNITVMMNFSCDDYDLLSEDMWSSAYFKIIVYMLYIPIFIFAL IGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCH FVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYATFIIAGVWFIALATALPIP IVSGLDIPMSPWHTKCEKYICREMWPSRTQEYYYTLSLFALQFVVPLGVLIFTYARITIR VWAKRPPGEAETNRDQRMARSKRKMVKMMLTVVIVFTCCWLPFNILQLLLNDEEFAHWDP LPYVWFAFHWLAMSHCCYNPIIYCYMNARFRSGFVQLMHRMPGLRRWCCLRSVGDRMNAT SGTGPALPLNRMNTSTTYISARRKPRATSLRANPLSCGETSPLR
Uniprot No.

Target Background

Function
This receptor functions as a receptor for the neuropeptides RYamide-1 and RYamide-2. Its activity is mediated by G proteins that activate a phosphatidyl-inositol-calcium second messenger system. RYamide signaling may play a role in suppressing feeding behavior.
Gene References Into Functions
  1. Two ligands of CG5811, dRYamide-1 and dRYamide-2, derived from CG40733, were identified. PMID: 21704020
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Drosophila melanogaster Neuropeptide Y receptor (NepYr)?

The Drosophila melanogaster Neuropeptide Y receptor (NepYr) is a membrane protein that functions as a receptor for neuropeptide signaling in the fruit fly nervous system. This receptor is also known by several alternative names including RYa-R, CG5811, RYamide receptor, and Neuropeptide Y-like receptor (NPY-R), with a UniProt ID of P25931 . The full-length receptor consists of 464 amino acids and plays a crucial role in neuronal signaling pathways that influence various physiological processes including memory formation. NepYr belongs to a family of neprilysins, which are type II metalloproteinases that degrade and inactivate small peptides, particularly involved in middle-term memory (MTM) and long-term memory (LTM) processes in Drosophila . Structurally, the receptor contains characteristic transmembrane domains typical of G-protein coupled receptors that enable the transduction of extracellular neuropeptide binding to intracellular signaling cascades.

Why is Drosophila melanogaster used as a model organism for studying neuropeptide receptors?

Drosophila melanogaster serves as an exceptional model organism for studying neuropeptide receptors due to its well-characterized genetics and relatively simple nervous system that still exhibits complex behaviors. The fruit fly genome has been fully sequenced, allowing for precise genetic manipulations through techniques such as RNA interference (RNAi) and CRISPR/Cas9 to target specific genes like those encoding neuropeptide receptors . Drosophila possesses well-defined neuronal circuits, particularly the mushroom bodies and dorsal paired medial neurons, which are crucial for memory formation and have been extensively mapped and characterized . The fly's short generation time and high fecundity enable large-scale genetic screens and rapid experimental cycles, facilitating the collection of statistically significant data . Additionally, approximately 75% of genes involved in Drosophila reproduction and neurological functions have vertebrate orthologs, making findings potentially translatable to higher organisms including humans .

How is recombinant NepYr protein typically expressed and purified for research purposes?

Recombinant Drosophila melanogaster Neuropeptide Y receptor (NepYr) protein is typically expressed using bacterial expression systems, with Escherichia coli being the most common host organism as documented in commercial preparations . The full-length protein (amino acids 1-464) is often fused with affinity tags, particularly an N-terminal histidine (His) tag, which facilitates purification through metal affinity chromatography . The expression typically involves cloning the NepYr coding sequence into a suitable expression vector containing a strong promoter and the His-tag sequence, followed by transformation into E. coli and induction of protein expression using appropriate conditions. After cell lysis, the tagged protein is purified using nickel or cobalt affinity columns, with subsequent washing steps to remove contaminants and elution with imidazole-containing buffers. The purified protein is often subjected to buffer exchange and concentration procedures before being lyophilized to form a stable powder that can be stored at -20°C to -80°C . Reconstitution of the lyophilized protein is recommended in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage stability .

What are the recommended storage and handling conditions for recombinant NepYr protein?

Optimal storage and handling of recombinant Drosophila melanogaster Neuropeptide Y receptor (NepYr) protein requires careful attention to temperature, buffer composition, and aliquoting practices to maintain structural integrity and biological activity. The purified recombinant protein is typically provided as a lyophilized powder that should be stored at -20°C to -80°C immediately upon receipt . Before opening the vial, brief centrifugation is recommended to bring the contents to the bottom and minimize product loss. For reconstitution, deionized sterile water is the preferred solvent, creating a solution with a concentration range of 0.1-1.0 mg/mL . To prevent protein degradation during long-term storage, the addition of glycerol to a final concentration of 5-50% (with 50% being standard) is strongly recommended, followed by division into small working aliquots to avoid repeated freeze-thaw cycles . For short-term use, working aliquots can be stored at 4°C for up to one week, though this should be avoided for valuable samples or when maximum activity is required. The reconstituted protein is typically maintained in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps preserve protein stability and functionality .

How can RNAi techniques be optimized for studying NepYr function in Drosophila neural circuits?

RNA interference (RNAi) can be precisely optimized for studying NepYr function in Drosophila neural circuits through several critical methodological considerations. First, the design of RNAi constructs requires careful sequence selection to ensure specificity for the NepYr gene while avoiding off-target effects; multiple non-overlapping RNAi constructs (such as RNAi-Nep1A and RNAi-Nep1B) should be used to confirm phenotypic results, as demonstrated in studies of neprilysin function . For enhancing RNAi efficacy, co-expression of Dicer2 enzyme significantly improves gene silencing as shown in neprilysin studies where UAS-Dicer2 was used to compensate for less efficient RNAi constructs . Temporal control of gene silencing can be achieved through the Gal80ts/Gal4-UAS system, allowing temperature-dependent activation of RNAi expression specifically during experimental time windows rather than throughout development, preventing developmental compensation mechanisms . Spatial precision in targeting specific neural circuits requires the selection of appropriate Gal4 driver lines, such as c739-Gal4 for mushroom body expression, combined with techniques like MARCM (Mosaic Analysis with a Repressible Cell Marker) for single-cell resolution . Quantitative validation of knockdown efficiency should be performed using RT-qPCR or Western blotting to correlate the degree of protein reduction with observed phenotypes, ensuring that behavioral deficits can be confidently attributed to NepYr silencing rather than technical variables.

What are the most effective behavioral assays for evaluating NepYr function in memory formation?

Evaluating NepYr function in memory formation requires sophisticated behavioral assays that can dissect different memory phases while controlling for confounding variables. The olfactory conditioning paradigm stands as the gold standard, where flies learn to associate an odor with either a reward (sugar) or punishment (electric shock), followed by testing their preference in a T-maze at different time points post-training; this approach allows differentiation between immediate memory, middle-term memory (MTM), and long-term memory (LTM) processes that may be differentially affected by NepYr manipulation . For memory extinction and reversal learning assessment, specialized protocols involving repeated unreinforced presentation of the conditioned stimulus or reversed contingencies can reveal NepYr's role in memory flexibility and updating mechanisms. Social learning paradigms, where flies observe and learn from conspecifics, provide an alternative approach that may engage different neural circuits and potentially different aspects of NepYr function than individual learning paradigms. Optogenetic manipulation combined with behavioral testing offers temporal precision by allowing researchers to activate or inhibit specific NepYr-expressing neurons during defined phases of memory acquisition, consolidation, or retrieval using light-activated channels expressed under UAS control in the same circuits where NepYr is being studied . Importantly, proper controls must include testing for sensory acuity and locomotor function, as deficits in odor perception, taste sensitivity, or movement could confound interpretation of memory phenotypes attributed to NepYr manipulation.

How can imaging techniques be employed to visualize NepYr localization and activity in living Drosophila neurons?

Advanced imaging techniques offer powerful approaches for visualizing NepYr localization and activity in living Drosophila neurons with high spatial and temporal resolution. Fluorescent protein tagging through CRISPR/Cas9-mediated knock-in of sequences encoding GFP or mCherry at the endogenous NepYr locus enables visualization of the receptor's native expression pattern without disrupting regulatory elements, while alternative UAS-driven expression of tagged NepYr can provide stronger signals in specific neuronal populations like the dorsal paired medial neurons or mushroom bodies where NepYr functions in memory formation . Super-resolution microscopy techniques, including STED (Stimulated Emission Depletion) or PALM (Photoactivated Localization Microscopy), can overcome the diffraction limit to reveal NepYr subcellular distribution within neuronal compartments at nanometer resolution, potentially identifying synaptic vs. extrasynaptic receptor pools. For monitoring receptor activity, FRET (Förster Resonance Energy Transfer) biosensors can be designed by sandwiching conformationally sensitive fluorophore pairs within the NepYr structure or its associated signaling proteins, allowing real-time visualization of conformational changes upon ligand binding or downstream signaling events. Calcium imaging using genetically encoded calcium indicators (GECIs) like GCaMP expressed in NepYr-positive neurons can indirectly measure receptor activity by detecting calcium influx following receptor activation, particularly when combined with olfactory stimulation in memory-related circuits . Ex vivo brain explant preparations maintain neural circuit integrity while providing optical accessibility for longer imaging sessions and precise pharmacological manipulations of NepYr activation or inhibition during imaging.

What molecular techniques can identify the endogenous ligands that activate the NepYr receptor?

Identifying endogenous ligands for the NepYr receptor requires a multilayered approach combining biochemical, genetic, and computational techniques. Affinity purification-mass spectrometry represents a cornerstone technique where recombinant NepYr protein (with His-tag or other affinity tags) is immobilized on a solid support and used to capture interacting peptides from Drosophila brain extracts, followed by elution and high-resolution mass spectrometry to identify the bound peptides; this approach has successfully identified RYamide as a bioactive peptide related to neuropeptide Y signaling . Complementary to direct binding studies, functional screening involves measuring NepYr activation using heterologous expression systems where the receptor is expressed in cell lines along with appropriate reporter systems (calcium indicators, cAMP sensors, or phosphorylation-specific antibodies) and systematically challenged with fractionated peptide libraries derived from Drosophila neural tissues. Genetic approaches using CRISPR/Cas9 to knock out candidate ligand-encoding genes, followed by evaluation of whether supplementation with synthetic peptides can rescue NepYr-dependent phenotypes, provide in vivo validation of ligand-receptor relationships. Bioinformatic analysis of the Drosophila proteome for peptides sharing structural similarities with known neuropeptide Y family members from other species can identify candidate ligands, particularly when combined with evolutionary conservation analysis across insect species. Cross-linking studies using photoactivatable ligand analogs that can be covalently attached to the receptor upon UV irradiation, followed by proteolytic digestion and mass spectrometry, can map the precise binding interfaces between NepYr and its ligands, providing structural insights into receptor specificity and activation mechanisms.

How can genetic approaches be used to study the functional relationship between NepYr and memory formation?

Genetic approaches provide powerful tools for dissecting the functional relationship between NepYr and memory formation in Drosophila through precise manipulations of gene expression and activity. The Drosophila Synthetic Population Resource (DSPR), comprising over 1700 recombinant inbred lines with high-resolution genetic maps, enables quantitative trait locus (QTL) mapping to identify genetic variants affecting NepYr function and associated memory phenotypes with greater precision than traditional mapping approaches . Temporally controlled gene expression using the Gal80ts/Gal4-UAS system allows researchers to induce NepYr knockdown or overexpression specifically during adulthood, circumventing developmental effects and targeting distinct memory phases (acquisition, consolidation, or retrieval) by manipulating temperature at specific time points relative to training . Cell-type specific manipulation through the use of highly restricted Gal4 driver lines can target NepYr expression in specific neuronal populations, such as the dorsal paired medial neurons or mushroom body neurons, which have been identified as critical sites for neprilysin function in memory formation . CRISPR/Cas9-mediated genome editing facilitates the generation of precise mutations in the NepYr gene, allowing structure-function analysis by creating specific amino acid substitutions in functional domains like the peptide-binding pocket or catalytic site, rather than complete gene knockout. Intersectional genetic strategies combining Gal4/UAS with alternative expression systems like LexA/LexAop allow simultaneous manipulation of NepYr in one neuronal population while monitoring activity in connected neurons, revealing circuit-level mechanisms of NepYr's influence on memory-related neural activity.

How does NepYr function in the dorsal paired medial neurons influence memory stability in Drosophila?

The function of NepYr in dorsal paired medial (DPM) neurons plays a critical role in stabilizing memory through specialized neuronal circuitry and peptide processing in Drosophila. Research has demonstrated that all four Drosophila neprilysins, including NepYr, are specifically required in the DPM neurons for both middle-term memory (MTM) and long-term memory (LTM) formation, with RNA interference targeting these genes in DPM neurons causing significant memory deficits . The DPM neurons form a single pair of neurons that broadly innervate the mushroom bodies (MB), which are the primary center for olfactory memory in Drosophila, creating an anatomical circuit specialized for memory stabilization rather than initial acquisition . Mechanistically, NepYr in DPM neurons likely regulates the balance of neuropeptides that modulate synaptic transmission between the DPM neurons and mushroom body neurons, with neprilysins degrading specific neuropeptides to maintain optimal signaling dynamics during the consolidation phase of memory formation. This memory stabilization function appears to involve feedback loops between the mushroom bodies and DPM neurons, where initial learning in the mushroom bodies triggers activity in DPM neurons, which then release modulatory neuropeptides that are subsequently processed by neprilysins like NepYr to maintain the appropriate duration and intensity of consolidation signals . The remarkable specificity of requiring all four neprilysins in this single pair of neurons suggests a complex and precisely regulated peptidergic signaling system underlying memory stabilization, with each neprilysin potentially targeting different neuropeptide substrates or acting at different stages of the consolidation process.

What role does NepYr play in neurodegenerative disease models in Drosophila?

NepYr and related neprilysins in Drosophila have significant implications for understanding and modeling neurodegenerative diseases, particularly Alzheimer's disease, through their enzymatic activities and neuroprotective functions. Neprilysins are the major amyloid-β (Aβ) peptide-degrading enzymes, positioning them as crucial players in preventing the accumulation of toxic Aβ deposits that characterize Alzheimer's disease pathology . In Drosophila models expressing human Aβ peptides, manipulation of neprilysin activity directly affects the severity of neurodegeneration and associated behavioral deficits, with neprilysin overexpression typically ameliorating these phenotypes while neprilysin deficiency exacerbates them. Beyond direct Aβ degradation, NepYr likely processes multiple neuropeptides involved in maintaining neuronal health and function, as evidenced by its requirement in specific memory-related circuits like the dorsal paired medial neurons and mushroom bodies . The availability of sophisticated genetic tools in Drosophila, including the Drosophila Synthetic Population Resource (DSPR) with its panel of over 1700 recombinant inbred lines, facilitates high-resolution mapping of genetic modifiers that influence NepYr function in neurodegenerative contexts . Drosophila NepYr studies also provide insights into the evolutionary conservation of neprilysin function, as Nep1 is the fly ortholog of human neprilysin (hNEP), suggesting that fundamental mechanisms of neuropeptide processing and their implications for neurodegeneration may be conserved from insects to mammals .

How can recombinant NepYr be used for high-throughput drug screening applications?

Recombinant NepYr protein offers a versatile platform for high-throughput drug screening applications targeting neuropeptide signaling pathways with implications for memory enhancement and neurodegenerative disease treatment. In vitro enzymatic assays using purified recombinant NepYr with His-tag can measure peptide degradation activity in the presence of candidate compounds, allowing rapid screening of libraries containing thousands of molecules for inhibitors or activators of NepYr function . Cell-based assays can be developed by expressing recombinant NepYr in cultured cells along with appropriate readout systems (fluorescent reporters, bioluminescent sensors, or electrophysiological measurements) to assess how compounds modulate receptor-mediated signaling in a cellular context. Thermal shift assays can evaluate compound binding to recombinant NepYr by measuring changes in protein thermal stability upon ligand binding, providing a label-free method to identify direct interactions between the receptor and candidate drugs. For secondary validation of promising compounds, Drosophila-based behavioral assays measuring memory performance can assess whether compounds that modulate NepYr activity in vitro also affect memory formation in vivo, similar to approaches used to quantify chemical effects on Drosophila fecundity in multi-well plate formats . This high-throughput screening approach aligns with the growing need for new approach methodologies (NAMs) being adopted by regulatory agencies worldwide, potentially accelerating the discovery of therapeutics targeting memory decline in aging and neurodegenerative conditions .

How does NepYr interact with other neuropeptide systems in regulating physiological processes?

NepYr interacts with multiple neuropeptide systems in Drosophila, creating a complex regulatory network that influences diverse physiological processes beyond memory formation. As a member of the neprilysin family of peptide-degrading enzymes, NepYr likely processes multiple neuropeptide substrates including those related to the RYamide system, which has been identified as containing bioactive peptides interacting with neuropeptide Y-like receptors in Drosophila . These cross-system interactions create regulatory feedback loops where the activity of one neuropeptide system influences others through enzymatic processing by neprilysins like NepYr. In the context of neural circuits, the requirement for all four neprilysins (including NepYr) in both the mushroom bodies and dorsal paired medial neurons suggests that precise regulation of multiple peptide signals is essential for normal circuit function, particularly in memory-related processes . Beyond the nervous system, neuropeptide Y-related signaling in Drosophila influences feeding behavior, stress responses, and reproductive functions including fecundity, suggesting that NepYr may indirectly modulate these processes through its peptide-processing activity . The evolutionary conservation of neprilysin function across species implies that insights from Drosophila NepYr studies may inform understanding of neuropeptide signaling networks in mammals, where neprilysins process peptides involved in cardiovascular regulation, pain perception, and inflammatory responses in addition to their roles in neurodegeneration .

What are the major challenges in expressing and purifying functional recombinant NepYr?

Expressing and purifying functional recombinant NepYr presents several significant challenges that require specialized techniques to overcome. The transmembrane nature of the NepYr receptor poses a fundamental obstacle as membrane proteins often misfold or aggregate when expressed in heterologous systems, particularly bacterial hosts like E. coli; this necessitates careful optimization of expression conditions including temperature, induction timing, and host strain selection . While E. coli expression systems are commonly used for NepYr production, the lack of post-translational modifications in prokaryotic systems may affect protein functionality if NepYr requires glycosylation or other eukaryotic modifications for proper folding and activity, potentially necessitating expression in insect cell lines or other eukaryotic systems for certain applications . Solubilization of the expressed receptor requires careful selection of detergents or lipid environments that maintain the native conformation while extracting the protein from membranes; too harsh detergents may denature the receptor while insufficient solubilization reduces yield. Maintaining the catalytic activity of neprilysins during purification requires special attention to buffer composition, including the presence of stabilizing agents like trehalose (used at 6% in commercial preparations) and appropriate pH conditions (typically pH 8.0 for NepYr) . Post-purification storage presents additional challenges, with repeated freeze-thaw cycles significantly reducing protein activity; this necessitates aliquoting into single-use volumes and the addition of stabilizing agents like glycerol (recommended at 5-50% final concentration) for long-term storage at -20°C or -80°C .

How can researchers overcome the blood-brain barrier challenges when studying NepYr-targeting compounds in vivo?

The blood-brain barrier (BBB) presents a significant challenge for studying NepYr-targeting compounds, but researchers can employ several specialized approaches to address this limitation in Drosophila models. Genetic manipulation of Drosophila blood-brain barrier permeability can be achieved through targeted knockdown of BBB component genes using the Gal4/UAS system with BBB-specific drivers, creating models with controlled permeability that allow otherwise excluded compounds to reach NepYr in the central nervous system. Direct brain injection techniques, while invasive, provide a reliable method to bypass the BBB entirely by delivering compounds directly to the brain tissue, with microinjection methods adapted for the small size of Drosophila allowing precise delivery to specific brain regions where NepYr functions in memory formation, such as the mushroom bodies or dorsal paired medial neurons . Chemical modification strategies can enhance BBB penetration of NepYr-targeting compounds by increasing lipophilicity, reducing molecular weight, or conjugating to transport vectors like cell-penetrating peptides or nanoparticles designed to exploit endogenous BBB transport systems. Ex vivo brain culture techniques offer an alternative approach where dissected Drosophila brains are maintained in culture medium, eliminating the BBB entirely and allowing direct application of compounds to brain tissue while maintaining the neural circuits required for electrophysiological or calcium imaging studies of NepYr function . Additionally, the relatively simpler structure of the Drosophila BBB compared to mammals can be exploited in initial screening efforts to identify compounds with even modest BBB penetration that can later be optimized for increased brain exposure.

What strategies can address the genetic redundancy among neprilysin family members in functional studies?

Addressing genetic redundancy among the four expressed neprilysin family members in Drosophila requires sophisticated experimental approaches to disentangle their overlapping functions. Simultaneous targeting of multiple neprilysins using combinatorial RNAi represents a powerful approach where multiple UAS-RNAi constructs targeting different neprilysin genes are co-expressed in the same cells, allowing researchers to assess whether phenotypic effects are enhanced compared to single gene knockdowns; this approach has revealed that all four neprilysins are required in the same neurons for proper memory formation . CRISPR/Cas9-mediated multiplex gene editing enables the creation of Drosophila lines with mutations in multiple neprilysin genes simultaneously, eliminating the need for complex genetic crosses to combine individual mutations and allowing analysis of double, triple, or even quadruple mutants to comprehensively assess redundancy. Domain-specific mutations targeted to conserved catalytic regions shared across neprilysin family members can disrupt enzymatic function while maintaining protein expression levels, potentially affecting all family members similarly if designed to target highly conserved residues essential for peptidase activity. Substrate specificity analysis using recombinant proteins can identify unique and overlapping peptide substrates for each neprilysin, providing insights into functional specialization versus redundancy and informing the design of more targeted experimental interventions. Tissue-specific or temporal expression patterns can be leveraged to identify unique roles despite biochemical redundancy, as demonstrated by the finding that all four neprilysins are required specifically in dorsal paired medial neurons for memory formation, suggesting that their co-expression in these neurons serves a critical non-redundant function despite potential enzymatic similarities .

How might single-cell transcriptomics advance our understanding of NepYr expression patterns in the Drosophila nervous system?

Single-cell transcriptomics represents a revolutionary approach that could significantly advance our understanding of NepYr expression patterns in the Drosophila nervous system by providing unprecedented cellular resolution and context. This technology would allow researchers to create comprehensive cellular atlases of NepYr expression across all neuronal and glial populations in the Drosophila brain, potentially revealing previously unrecognized cell types that express the receptor at levels below the detection threshold of conventional histological methods . Temporal profiling of NepYr expression at the single-cell level during memory formation could identify dynamic changes in expression patterns following learning experiences, potentially uncovering how NepYr regulation contributes to the transition from short-term to middle-term and long-term memory phases. Co-expression analysis mapping the relationship between NepYr and other genes at single-cell resolution would identify molecular signatures of NepYr-expressing neurons, potentially revealing co-regulatory networks and functional modules that could explain the receptor's role in specific neuronal circuits like the dorsal paired medial neurons and mushroom bodies . Comparative single-cell analysis between wild-type flies and memory mutants could identify compensatory changes in NepYr expression that occur in response to deficits in other memory pathways, providing insights into the receptor's role in maintaining homeostasis within memory circuits. Additionally, integration of single-cell transcriptomics with connectomic data mapping neuronal projections would create a multimodal atlas linking NepYr expression to specific circuit architectures, potentially explaining how the receptor's activity in specific neurons like the dorsal paired medial neurons influences broader network function during memory processing.

What potential applications exist for NepYr in developing novel insect control strategies?

The Drosophila melanogaster Neuropeptide Y receptor (NepYr) presents intriguing opportunities for developing novel insect control strategies with potential applications in agriculture and public health. Target-specific insecticides could be developed by designing compounds that selectively bind to insect NepYr while having minimal affinity for mammalian neprilysins, exploiting structural differences between these evolutionarily related but distinct proteins; this approach could lead to pest control agents with reduced environmental toxicity compared to broad-spectrum insecticides like bendiocarb, which affects insect fecundity at micromolar concentrations . RNA interference-based approaches could utilize dsRNA targeting NepYr delivered through feeding or specialized formulations to suppress receptor expression in target insect pests, potentially disrupting neurological functions including memory formation that are essential for foraging, mating, and other survival behaviors . Genetic control strategies such as gene drive systems could spread NepYr mutations through pest populations, potentially creating memory deficits that reduce fitness under field conditions where learning is essential for adapting to changing environments and avoiding control measures. The high-throughput fecundity quantification methods developed for Drosophila could be adapted to screen candidate compounds targeting NepYr for effects on reproductive output in agricultural pests or disease vectors, providing an efficient system for identifying promising insect control agents . Furthermore, comparative analysis of NepYr structure and function across insect species could identify conserved features that could be targeted in multiple pest species simultaneously, as well as species-specific differences that could be exploited for the selective control of particular problem species while sparing beneficial insects.

How can computational modeling enhance our understanding of NepYr structure-function relationships?

Computational modeling offers powerful approaches for understanding NepYr structure-function relationships by integrating diverse experimental data with predictive algorithms. Homology modeling based on crystal structures of related neprilysins can generate three-dimensional structural models of NepYr, providing insights into the spatial arrangement of catalytic residues, substrate binding pockets, and potential regulatory domains that influence the receptor's peptide degradation activity and selectivity . Molecular dynamics simulations can model the dynamic behavior of NepYr in membrane environments, revealing conformational changes associated with substrate binding, catalysis, and protein-protein interactions under physiological conditions that may explain its specific role in memory-related neural circuits. Docking simulations with candidate peptide substrates and small molecule inhibitors can predict binding affinities and interaction modes, guiding experimental validation and rational design of compounds that modulate NepYr activity with potential applications in memory enhancement or insect control strategies . Machine learning approaches integrating data from RNAi screens, behavioral assays, and expression studies can identify patterns and relationships that may not be apparent through conventional analysis, potentially revealing unexpected connections between NepYr function and phenotypic outcomes. Sequence-based analysis across species can identify evolutionary conservation patterns in neprilysin family members, highlighting functionally critical regions maintained through natural selection while also revealing species-specific adaptations that could be exploited for selective targeting in pest control applications . These computational approaches complement experimental studies by generating testable hypotheses about NepYr function, prioritizing experimental directions, and providing mechanistic explanations for observed phenotypes in the complex context of memory formation and neurological function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.