Recombinant Drosophila melanogaster Nuclear envelope phosphatase-regulatory subunit 1 homolog (CG8009)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Drosophila melanogaster Nuclear envelope phosphatase-regulatory subunit 1 homolog (CG8009) is a protein present in Drosophila melanogaster . It is also known as Nuclear envelope phosphatase-regulatory subunit 1 homolog . The gene that encodes it is CG8009, and its accession code is Q8T0B1 .

Table 1: Protein Information

CategoryInformation
Protein NameNuclear envelope phosphatase-regulatory subunit 1 homolog
Accession CodeQ8T0B1
GeneCG8009
OrganismDrosophila melanogaster
Part of Reference Proteome?Yes
Sequence Length131

Subcellular Location

CG8009 is located in the nuclear envelope, which is a membrane system that surrounds the nucleoplasm of eukaryotic cells . The nuclear envelope consists of the nuclear lamina, nuclear pore complexes, and two nuclear membranes, with the nuclear intermembrane space in between . CG8009 is also found in the nuclear membrane . This term applies when the protein's presence within the inner or outer nuclear membrane is not definitively known .

Table 2: Position in the Nuclear Envelope

LocationLocation IDDescription
Nuclear EnvelopeSL-0178The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear MembraneSL-0182The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.

Biology and Function

CG8009 may form an active complex with serine/threonine protein phosphatase l(1)G0269, which dephosphorylates and activates lipin-like phosphatases . Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at different levels .

Interactions

The protein interacts with other proteins . It has two listed interactors .

Role in Lipid Metabolism

Drosophila Torsin (dTorsin) affects lipid metabolism via the NEP1R1‐CTDNEP1 phosphatase and the Lipin phosphatidic acid (PA) phosphatase . Torsins remove NEP1R1‐CTDNEP1 from the NE in fly and mouse cells, leading to subsequent Lipin exclusion from the nucleus .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CG8009; Nuclear envelope phosphatase-regulatory subunit 1 homolog; Transmembrane protein 188
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG8009
Target Protein Sequence
MEPSACEDLKAFERRLTEVVSSYRPSTFRWRKLLAVVLSAMSMCTAISAWYWLRDPRTTV VPLTESLWIHPVFTVATLTLVVLFILGIQKLVIAPQIITSRTRMVLGDFNMSCDDTGKLI LKPRQSNNNST
Uniprot No.

Target Background

Function
This protein may form an active complex with serine/threonine protein phosphatase 1 (PP1; G0269), dephosphorylating and activating lipin-like phosphatases. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol, thus playing a crucial role in regulating fatty acid metabolism.
Database Links

KEGG: dme:Dmel_CG8009

STRING: 7227.FBpp0075984

UniGene: Dm.2129

Protein Families
CNEP1R1 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Cytoplasm.

Q&A

What is Nuclear Envelope Phosphatase-Regulatory Subunit 1 Homolog (CG8009) in Drosophila melanogaster?

Nuclear envelope phosphatase-regulatory subunit 1 homolog (CG8009) is a transmembrane protein in Drosophila melanogaster that functions as a regulatory subunit for phosphatase enzymes associated with the nuclear envelope. This protein is also known as Transmembrane protein 188 based on its structural characteristics . CG8009 is homologous to the mammalian Nuclear Envelope Phosphatase 1 Regulatory subunit 1 (NEP1R1), which forms a complex with CTD-Nuclear Envelope Phosphatase 1 (CTDNEP1) to regulate lipid metabolism and membrane biogenesis .

The protein plays a crucial role in membrane biology through its regulatory function on phosphatases that control lipid synthesis pathways. Research has demonstrated that this phosphatase system is evolutionarily conserved across species, from yeast (Nem1-Spo7) to C. elegans (CNEP-1) to mammals (CTDNEP1-NEP1R1), underscoring its fundamental importance in cellular biology .

What is the Cellular Localization of CG8009?

Based on studies of homologous proteins, CG8009 is predicted to localize primarily to the nuclear envelope and endoplasmic reticulum. Drawing parallels with mammalian research, the protein likely shows a punctate pattern at the nuclear envelope and co-localizes with ER markers, particularly in the perinuclear region .

The localization pattern is functionally significant as it positions the protein at sites where lipid synthesis regulation is critical. Some evidence from mammalian systems suggests that homologous proteins may also localize to lipid droplets under specific metabolic conditions, indicating a potential role in lipid storage regulation .

The N-terminal region of the protein, particularly if it contains an amphipathic helix similar to its mammalian counterpart, would be crucial for targeting to these membrane structures .

How is CG8009 Related to NEP1R1 in Mammals?

CG8009 is the Drosophila homolog of mammalian NEP1R1 (Nuclear Envelope Phosphatase 1 Regulatory subunit 1). The functional relationship between these proteins extends beyond sequence similarity to include conserved regulatory mechanisms:

  • Both proteins function as regulatory subunits for nuclear envelope phosphatases

  • They share similar subcellular localization patterns

  • Both participate in lipid metabolism regulation through similar molecular pathways

  • The protein-protein interaction interfaces are likely conserved across species

In mammalian systems, NEP1R1 forms a complex with CTDNEP1 to control the phosphorylation state of lipin 1, thereby regulating diacylglycerol (DAG) production in the ER . This mechanism appears to be evolutionarily conserved, suggesting that CG8009 likely performs a comparable function in Drosophila by regulating phosphatases that control lipid synthesis pathways.

What are the Standard Methods for Studying CG8009 Expression?

Several methodological approaches are effective for studying CG8009 expression:

  • Recombinant Protein Production: Expressing recombinant CG8009 with appropriate tags for functional studies

  • Gene Editing: CRISPR-Cas9 gene editing to insert fluorescent tags (e.g., EGFP) at the endogenous CG8009 locus, similar to approaches used for mammalian CTDNEP1

  • Immunofluorescence Microscopy: Using tagged versions of the protein to visualize subcellular localization

  • RNA Interference (RNAi): For depletion studies to assess functional consequences

  • Co-Immunoprecipitation: To identify protein-protein interactions

The standard experimental workflow typically involves:

  • Generating tagged versions of CG8009 or using antibodies against the endogenous protein

  • Assessing expression levels through Western blotting

  • Determining subcellular localization through microscopy techniques

  • Conducting functional assays to assess the impact on lipid metabolism

How Does CG8009 Interact with Other Proteins in the Nuclear Envelope?

Based on research with mammalian homologs, CG8009 likely forms a complex with phosphatase enzymes at the nuclear envelope. In mammals, NEP1R1 interacts with CTDNEP1 through specific binding interfaces that have been identified through mutagenesis studies .

A key finding from mammalian studies is that NEP1R1 binding stabilizes CTDNEP1 by protecting it from proteasomal degradation. This interaction is crucial for maintaining functional levels of the phosphatase at the nuclear envelope . By extrapolation, CG8009 may similarly stabilize its partner phosphatase in Drosophila.

The binding interface likely involves specific residues that have been conserved through evolution. In mammalian systems, mutation of valine 233 to glutamic acid (V233E) in CTDNEP1 disrupts binding to NEP1R1 . Comparative sequence analysis could identify similar critical residues in the Drosophila proteins that mediate these interactions.

The methodology for studying these interactions includes:

  • Reciprocal co-immunoprecipitation assays

  • Site-directed mutagenesis to identify critical binding residues

  • Fluorescence resonance energy transfer (FRET) to visualize interactions in living cells

  • In vitro binding assays with purified recombinant proteins

What Role Does CG8009 Play in Lipid Metabolism and ER Membrane Biogenesis?

Drawing from research on mammalian homologs, CG8009 likely plays a critical role in regulating lipid metabolism and ER membrane biogenesis in Drosophila. The conserved function across species suggests that CG8009 participates in a regulatory pathway controlling diacylglycerol (DAG) production, which is a critical intermediate for both membrane and storage lipid synthesis .

In mammalian systems, the CTDNEP1-NEP1R1 complex regulates the phosphorylation state of lipin 1, which is the main enzyme producing DAG in the ER . Specifically, CTDNEP1 dephosphorylates lipin 1, promoting its translocation to the nucleus and restricting ER membrane expansion .

By analogy, CG8009 likely regulates Drosophila phosphatases that control lipid synthesis pathways, potentially through:

  • Stabilizing phosphatase enzymes at the nuclear envelope

  • Directing phosphatase activity toward specific substrates

  • Coordinating lipid synthesis with cellular needs

Experimental evidence from mammalian studies shows that disruption of this regulatory system leads to excessive ER membrane production and altered lipid droplet biogenesis . Similar phenotypes might be observed in Drosophila with disrupted CG8009 function.

What Experimental Approaches Are Most Effective for Studying CG8009 Function?

Several advanced experimental approaches are particularly effective for studying CG8009 function:

  • CRISPR-Cas9 Gene Editing:

    • Creating knockout models to assess loss-of-function phenotypes

    • Generating endogenously tagged versions for localization studies

    • Introducing specific mutations to disrupt protein interactions

  • Lipidomic Analysis:

    • Quantitative assessment of lipid species changes upon CG8009 manipulation

    • Tracking metabolic flux through lipid synthesis pathways

  • Electron Microscopy:

    • Ultrastructural analysis of ER and nuclear envelope morphology

    • Immunogold labeling to precisely localize CG8009

  • Live Cell Imaging:

    • Tracking dynamic changes in CG8009 localization during metabolic challenges

    • FRAP (Fluorescence Recovery After Photobleaching) to assess protein mobility

  • Genetic Interaction Studies:

    • Systematic analysis of genetic interactions with lipid metabolism genes

    • Suppressor/enhancer screens to identify functional partners

A particularly powerful approach would be combining CRISPR-engineered flies expressing fluorescently tagged CG8009 with pharmacological or genetic manipulation of lipid metabolism pathways to assess functional consequences in vivo.

How Does the N-terminal Amphipathic Helix Affect the Localization and Function of CG8009?

Research on mammalian CTDNEP1 has revealed that its N-terminal amphipathic helix is crucial for targeting to the ER/nuclear envelope and lipid droplets . By analogy, if CG8009 contains a similar structural feature, it would likely play a comparable role in Drosophila.

The functional significance of this amphipathic helix has been demonstrated in mammalian systems through deletion and chimeric protein studies. Specifically:

  • Deletion of the amphipathic helix (ΔAH) reduces ER/nuclear envelope localization

  • The amphipathic helix is required for complex formation with regulatory partners

  • Membrane targeting via the amphipathic helix is prerequisite for phosphatase activity

To study this feature in CG8009, researchers could employ:

  • Structure prediction algorithms to identify potential amphipathic helices

  • Mutagenesis of key residues within the predicted helix

  • Creation of deletion constructs lacking the putative amphipathic helix

  • Chimeric proteins where the amphipathic helix is replaced with known membrane-targeting domains

The experimental readouts would include assessment of:

  • Protein localization through microscopy

  • Complex formation through co-immunoprecipitation

  • Functional consequences through lipid analysis and ER morphology assessment

What Are the Implications of CG8009 Dysregulation in Drosophila Models?

Dysregulation of CG8009 in Drosophila models would likely have significant implications for cellular lipid homeostasis, based on what is known about related proteins in mammalian systems. Potential consequences include:

  • Altered ER Membrane Architecture:

    • Excessive ER membrane production

    • Abnormal nuclear envelope morphology

    • Changes in ER-nuclear envelope connections

  • Disrupted Lipid Metabolism:

    • Altered balance between membrane and storage lipids

    • Changes in lipid droplet formation and size

    • Modified fatty acid synthesis pathways

  • Developmental Consequences:

    • Effects on cell division due to nuclear envelope abnormalities

    • Tissue-specific impacts in lipid-rich organs

    • Potential metabolic stress responses

Based on mammalian studies, disruption of this regulatory system affects both membrane biogenesis and lipid storage processes . Interestingly, research suggests that the regulation of these processes might be differently governed, with NEP1R1 being critical for membrane biogenesis control but less important for lipid droplet regulation .

Experimental approaches to study these implications include genetic manipulation coupled with comprehensive phenotypic analysis across developmental stages and under various metabolic conditions.

How Do Mutations in CG8009 Affect Lipid Droplet Formation and ER Membrane Expansion?

Research on mammalian systems provides insights into how mutations in CG8009 might affect lipid droplet formation and ER membrane expansion in Drosophila. In mammalian cells, CTDNEP1 activity restricts both ER membrane expansion and lipid droplet biogenesis, but through potentially different mechanisms .

Key findings that might translate to Drosophila include:

  • CTDNEP1 phosphatase activity restricts lipid droplet formation in cells fed with excess fatty acids

  • The mechanism regulating CTDNEP1 in lipid droplet biogenesis differs from that controlling ER membrane production

  • NEP1R1 binding is critical for CTDNEP1's role in restricting ER membrane expansion but less important for lipid droplet regulation

The differential reliance on regulatory partners suggests a metabolic rewiring of the phosphatase system when cells transition from membrane synthesis to lipid storage .

To study this in Drosophila, researchers could:

  • Create specific mutations in CG8009 that disrupt interaction with partner proteins

  • Challenge flies with high-fat diets to assess lipid droplet formation

  • Examine ER morphology through microscopy techniques

  • Conduct tissue-specific knockdowns to assess organ-specific effects

A comprehensive experimental design would include:

  • Generation of CG8009 mutants (null, binding-deficient, and catalytically inactive)

  • Metabolic challenge experiments (starvation, high-fat feeding)

  • Quantitative assessment of lipid droplet number, size, and composition

  • ER morphology analysis using fluorescent markers and electron microscopy

Can CG8009 Be Used as a Model to Study Similar Proteins in Mammalian Systems?

CG8009 represents a valuable model for studying the conserved functions of nuclear envelope phosphatase regulatory systems across species. Several factors make this Drosophila protein useful for understanding mammalian counterparts:

  • Evolutionary Conservation:

    • The phosphatase regulatory system is conserved from yeast to humans

    • Key functional domains and interactions appear to be maintained

  • Genetic Tractability:

    • Drosophila offers powerful genetic tools not readily available in mammalian systems

    • Tissue-specific manipulation is more straightforward

    • Development occurs rapidly, allowing for efficient experimental timelines

  • Reduced Genetic Redundancy:

    • Simpler genome may reduce compensatory mechanisms that complicate mammalian studies

    • Clearer phenotypes might emerge from single gene manipulations

A comparative research approach would involve:

  • Parallel studies of equivalent mutations in both systems

  • Rescue experiments testing if mammalian proteins can complement Drosophila mutants

  • Structure-function analyses to identify conserved regulatory mechanisms

This approach is supported by successful precedents where Drosophila has provided crucial insights into mammalian lipid metabolism pathways, particularly in aspects of lipid droplet biology and membrane dynamics.

What Techniques Can Be Used to Visualize CG8009 Localization in Living Cells?

Advanced imaging techniques can provide valuable insights into CG8009 localization and dynamics in living cells:

  • Fluorescent Protein Tagging:

    • CRISPR-Cas9 editing to create endogenously tagged CG8009-EGFP fusion proteins

    • Expression of fluorescently tagged proteins under native promoters

  • Super-Resolution Microscopy:

    • Structured illumination microscopy (SIM) to resolve subcellular structures beyond the diffraction limit

    • Stochastic optical reconstruction microscopy (STORM) for nanoscale resolution

  • Multi-Channel Live Imaging:

    • Co-visualization with ER markers (e.g., Sec61β) to track association with the ER

    • Co-labeling with lipid droplet dyes to assess recruitment during lipid storage

  • Dynamic Analysis Techniques:

    • Fluorescence recovery after photobleaching (FRAP) to measure protein mobility

    • Photoactivatable fluorescent proteins to track protein movement from specific subcellular compartments

For optimal results, a methodology similar to what has been used for mammalian CTDNEP1 could be applied:

  • Generate CRISPR-Cas9 gene edited cell lines with EGFP inserted at the endogenous CG8009 locus

  • Co-express markers for ER (mRFP-Sec61β), nuclear envelope, and lysosomes (Lamp1-mScarlet)

  • Apply various metabolic challenges to observe dynamic relocalization

  • Quantify punctate patterns and co-localization with different cellular compartments

This approach has revealed that mammalian CTDNEP1 shows a punctate pattern at the nuclear envelope and co-localizes with ER markers in the perinuclear region, with some protein also detected in lysosomal structures .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.