Recombinant Drosophila melanogaster Nurim homolog (nrm)

Shipped with Ice Packs
In Stock

Description

Recombinant Production of Nurim Homolog

The production of recombinant forms of Nurim homolog proteins has significantly advanced research capabilities by providing purified protein for structural and functional studies. Recombinant protein technology allows for controlled expression and purification of specific proteins, often incorporating tags to facilitate detection and isolation.

Expression Systems and Purification

Based on information from related recombinant proteins, the production of Recombinant Drosophila melanogaster Nurim homolog typically employs bacterial expression systems such as Escherichia coli. This approach offers advantages in terms of scalability and yield. The recombinant protein is often engineered to include fusion tags such as histidine (His) tags for simplified purification using affinity chromatography .

The purification process generally involves:

  1. Expression in an appropriate host organism (commonly E. coli)

  2. Cell lysis to release the recombinant protein

  3. Affinity chromatography using the engineered tag

  4. Additional purification steps as needed to achieve high purity

  5. Quality assessment through techniques such as SDS-PAGE

For example, in the related D. pseudoobscura protein, the recombinant form includes an N-terminal His tag and can be purified to greater than 90% purity as determined by SDS-PAGE analysis .

Research Applications

Nurim homolog proteins have important applications in research related to nuclear envelope structure and function. While specific research applications of D. melanogaster Nurim homolog are not extensively documented in the provided sources, several potential applications can be inferred based on the protein's characteristics and related research.

Functional Studies of Nuclear Envelope

Recombinant Nurim homolog proteins can serve as valuable tools for investigating nuclear envelope organization and dynamics. The nuclear envelope plays crucial roles in cellular processes including gene expression regulation, nuclear transport, and cell division. Studies using recombinant Nurim homolog can help elucidate the protein's specific contributions to these processes in Drosophila melanogaster.

Comparative Evolutionary Studies

The availability of recombinant Nurim homolog proteins from different Drosophila species enables comparative studies to understand evolutionary conservation and divergence. Such studies could provide insights into the functional significance of specific protein domains and their roles in nuclear envelope structure across species.

Genetic Analysis and Expression Patterns

Although the search results do not provide direct information on the genetic analysis of D. melanogaster Nurim homolog, related studies in Drosophila have employed sophisticated genetic approaches to understand gene function and expression patterns. For instance, techniques like in situ hybridization have been used to examine the expression of other Drosophila proteins in the nervous system during embryogenesis and in various developmental tissues .

The expression patterns of nuclear envelope proteins often exhibit tissue-specific and developmental regulation. For example, other Drosophila proteins involved in membrane dynamics show expression in the nervous system and secretory tissues, with developmental modulation suggesting that quantitative changes in membrane-associated proteins are important in histogenesis .

Comparative Analysis with Related Proteins

Understanding the Drosophila melanogaster Nurim homolog benefits from comparative analysis with related proteins. The Drosophila research field has identified multiple homologs of various proteins, including the identification of second homologs of proteins like N-Ethylmaleimide-sensitive fusion protein (NSF) . Such discoveries highlight the existence of protein families with specialized functions in different tissues or developmental stages.

While the provided search results do not specifically address multiple Nurim homologs in Drosophila melanogaster, the identification of protein families in this model organism is a common theme. For instance, dNSF-2 shows 84.5% identity to dNSF-1 and varying degrees of similarity to homologs from other species . This suggests that detailed analysis of Nurim homologs across species could reveal important functional and evolutionary relationships.

Recombination Studies in Drosophila

Although not directly related to Nurim homolog proteins, research in Drosophila has demonstrated homologous recombination between mitochondrial genomes, suggesting sophisticated genetic exchange mechanisms in this model organism . These findings highlight the complexity of genetic interactions in Drosophila and the importance of recombinant protein studies in understanding gene function.

The ability to detect recombination events has been enhanced through sophisticated selection methods that can reveal even rare genetic exchanges. For example, double-strand breaks have been shown to enhance recombination in the germline and reveal somatic recombination in Drosophila . Such methodologies could potentially be applied to studies involving nuclear envelope proteins like Nurim homolog.

Future Research Directions

Future research on Recombinant Drosophila melanogaster Nurim homolog could focus on several promising directions:

  1. Detailed structural analysis using crystallography or cryo-electron microscopy to elucidate the three-dimensional structure

  2. Interaction studies to identify binding partners within the nuclear envelope complex

  3. Functional studies using CRISPR-Cas9 gene editing to understand the consequences of protein modification

  4. Tissue-specific expression analysis throughout development

  5. Comparative studies with Nurim homologs from other species to understand evolutionary conservation

These approaches would significantly advance our understanding of this important nuclear envelope protein and its roles in cellular function.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
nrm; CG7655; Nurim homolog; Nuclear envelope membrane protein; Nuclear rim protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
nrm
Target Protein Sequence
MTSIAKSIVLLASLATFAYSLYVVGSLMMFLSTPRSISKAHTWIFNLLDNKSRLQTAYGP VVFDTLYLIGFIFQHSFLKSAVVKKLLAKLGLSGAERTIYSLTSSLCLHYLIVNWLPAQS IVLWQIDVEQSAPLWWTFVITHGICWVVIFGGSLVMDLPELLGVKQAYYDLKAYGPPISY KSGELRNLYAHVRHPSFVGLSVILFATNVMSVDRLVMALLLTTYMYLAWSTDQKDVAYQK IQLQRKKLELKAK
Uniprot No.

Target Background

Database Links

KEGG: dme:Dmel_CG7655

STRING: 7227.FBpp0082912

UniGene: Dm.1232

Protein Families
Nurim family
Subcellular Location
Nucleus inner membrane; Multi-pass membrane protein.

Q&A

What is the Drosophila melanogaster Nurim homolog and what is its cellular localization pattern?

The Drosophila melanogaster Nurim homolog (nrm) is a nuclear rim protein that functions in nuclear envelope organization. Similar to other Drosophila proteins studied in the digestive tract and Malpighian tubules, nrm likely has tissue-specific expression patterns . The protein contains conserved transmembrane domains that anchor it to the nuclear membrane, where it contributes to nuclear integrity and potentially regulates nucleocytoplasmic transport. Expression studies using the FlyBase database can provide comprehensive information about tissue-specific expression patterns throughout developmental stages .

What expression systems are most effective for producing recombinant Drosophila nrm protein?

For recombinant expression of Drosophila proteins, bacterial expression systems using truncated, soluble forms have proven effective, as demonstrated with Drosophila heme oxygenase . When expressing nrm:

  • Bacterial expression system optimization: Similar to the approach with Drosophila heme oxygenase, creating a truncated form (e.g., DmΔnrm) that lacks hydrophobic transmembrane domains can improve solubility and yield .

  • Purification strategy: A combination of affinity chromatography and size exclusion methods typically yields the purest protein preparations.

  • Expression verification: Western blotting using antibodies against conserved domains or epitope tags provides confirmation of successful expression.

  • Activity assessment: Functional assays specific to nuclear membrane proteins should be established to verify that the recombinant protein maintains native activity.

How can I verify the correct folding and functionality of recombinant nrm?

Verification of properly folded and functional recombinant nrm requires multiple approaches:

Verification MethodTechnical ApproachExpected Outcome
Spectroscopic AnalysisCircular dichroism (CD) spectroscopySecondary structure profile consistent with membrane protein
Binding AssaysPull-down assays with known interactorsSpecific interaction with nuclear envelope proteins
Cellular LocalizationTransfection of tagged protein into Drosophila cell linesNuclear envelope localization
Functional ComplementationRescue of nrm mutant phenotypesRestoration of normal nuclear envelope morphology

Analyzing the protein's ability to incorporate into nuclear membranes and interact with known partners provides the most reliable assessment of functionality, similar to approaches used with other Drosophila proteins .

What gene editing approaches are most effective for studying nrm function in Drosophila?

Several gene editing approaches can be employed to study nrm function:

  • CRISPR/Cas9 system: This provides precise gene editing capabilities to generate null mutations or domain-specific alterations in the nrm gene. Design guide RNAs targeting conserved regions of the gene for complete knockout or specific functional domains for more nuanced studies.

  • P-element-mediated transformation: While less precise than CRISPR, this established Drosophila technique can be used to create transgenic flies expressing modified versions of nrm.

  • GAL4-UAS system: This allows tissue-specific expression or knockdown of nrm to investigate its function in different cellular contexts, similar to studies of other nuclear proteins in Drosophila .

  • Direct Repeat assays: As demonstrated with other Drosophila genes, using direct repeat constructs (similar to DR-white assays) can help evaluate the effects of nrm mutations on nuclear integrity and function .

When designing genetic approaches, consider the potential redundancy with other nuclear envelope proteins to avoid misinterpretation of phenotypes.

How can I design an effective RNAi screen to identify interaction partners of nrm?

Designing an effective RNAi screen for nrm interaction partners requires:

  • Selection of appropriate cell line: Drosophila S2 cells are commonly used for RNAi screening due to their ease of culture and high transfection efficiency.

  • Phenotypic readout: Establish a clear readout for nrm function disruption, such as nuclear morphology changes, mislocalization of nuclear proteins, or altered nuclear envelope integrity.

  • Validation strategy:

    • Primary screen: Genome-wide dsRNA library targeting Drosophila genes

    • Secondary screen: Different dsRNA constructs targeting the same genes identified in the primary screen

    • Tertiary validation: Co-immunoprecipitation or proximity labeling to confirm physical interactions

  • Controls: Include known nuclear envelope proteins and completely unrelated proteins as positive and negative controls, respectively.

Analysis should focus on proteins that, when depleted, phenocopy nrm loss-of-function, suggesting functional relationships within the same pathway .

How does nrm contribute to nuclear envelope integrity during cellular stress responses?

The role of nrm in nuclear envelope integrity during stress responses can be investigated through:

  • Oxidative stress challenges: Treating Drosophila cells or tissues with oxidizing agents (H₂O₂, paraquat) to assess whether nrm is involved in stress protection pathways. This approach mirrors studies on Keap1/Nrf2 signaling in Drosophila, which demonstrated protection against oxidative stress .

  • Heat shock experiments: Exposing wild-type and nrm-deficient cells to elevated temperatures to evaluate nuclear envelope resistance to stress.

  • Mechanical stress assays: Using microfluidic devices to apply controlled mechanical forces to nuclei and assess integrity differences between control and nrm-depleted cells.

  • DNA damage response: Investigating whether nrm influences nuclear compartmentalization of DNA repair machinery during double-strand break repair, similar to studies of the DNA repair machinery in Drosophila .

Research has shown that nuclear envelope proteins often play critical roles in maintaining nuclear compartmentalization during stress conditions, and nrm may function similarly to maintain nuclear-cytoplasmic boundaries during cellular insults .

What is the relationship between nrm and chromatin organization in Drosophila?

The relationship between nrm and chromatin organization can be investigated through:

  • Chromatin immunoprecipitation (ChIP): To identify genomic regions associated with nrm, particularly at the nuclear periphery.

  • DamID technology: Fusion of DNA adenine methyltransferase to nrm can map chromatin regions that interact with the nuclear periphery in living cells.

  • Hi-C analysis: Comparing chromosome conformation capture data between wild-type and nrm mutant cells to identify changes in three-dimensional genome organization.

Analysis should focus on:

  • Heterochromatin distribution, especially at the nuclear periphery

  • Changes in gene expression profiles of peripheral genes

  • Alterations in chromosome territories

These approaches have been successfully employed in Drosophila to study nuclear organization and can be adapted specifically for nrm research .

How can single-cell RNA sequencing be applied to understand nrm-dependent gene expression?

Single-cell RNA sequencing (scRNA-seq) provides powerful insights into nrm-dependent gene expression changes:

  • Experimental design considerations:

    • Compare wild-type, nrm-knockout, and nrm-overexpressing Drosophila tissues

    • Include developmental time points if nrm has stage-specific functions

    • Consider tissue-specific effects, particularly in tissues where nrm is highly expressed

  • Analysis pipeline:

    • Cell clustering to identify populations differentially affected by nrm status

    • Differential expression analysis between genotypes within each cell cluster

    • Gene Ontology and pathway enrichment to identify affected cellular processes

    • Trajectory analysis to detect developmental or differentiation defects

  • Validation approaches:

    • RT-qPCR for key differentially expressed genes

    • In situ hybridization to confirm spatial expression changes

    • Chromatin accessibility assays (ATAC-seq) to correlate with expression changes

Recent FlyBase updates have incorporated single-cell RNA sequencing data, providing valuable reference datasets for comparison with nrm-specific studies .

How can I resolve issues with protein stability when working with recombinant nrm?

Resolving stability issues with recombinant nrm requires systematic optimization:

ChallengeSolution StrategyImplementation Details
AggregationDomain engineeringCreate truncated constructs removing hydrophobic transmembrane regions, similar to strategies used for Drosophila heme oxygenase
Oxidation sensitivityBuffer optimizationInclude reducing agents (DTT, β-mercaptoethanol) and work under anaerobic conditions when necessary
Proteolytic degradationProtease inhibitorsUse a cocktail of inhibitors targeting serine, cysteine, and metalloproteinases during purification
Expression toxicityInducible systemsEmploy tightly regulated expression systems (e.g., T7 lac or araBAD) to minimize toxicity to host cells

Structural predictions can guide the design of more stable constructs by identifying flexible regions that may contribute to instability. Consider fusion partners like MBP or SUMO that enhance solubility while maintaining native structure .

What are the best approaches for studying nrm interactions with the DNA repair machinery?

To study potential interactions between nrm and DNA repair machinery:

  • Colocalization studies: Use immunofluorescence to visualize nrm distribution relative to DNA repair proteins (like those involved in homologous recombination) following DNA damage induction with agents like ionizing radiation.

  • Repair pathway assays: Employ reporter constructs similar to the DR-white assay used in Drosophila to measure repair pathway choice (HR vs. NHEJ vs. SSA) in the presence or absence of functional nrm .

  • Proximity labeling: Use BioID or APEX2 fused to nrm to identify proteins in close proximity at the nuclear envelope, particularly after DNA damage.

  • Epistasis analysis: Compare phenotypes of single mutants (nrm, DNA repair genes) with double mutants to establish genetic relationships, similar to studies with Blm helicase in Drosophila .

Since nuclear envelope proteins can influence DNA repair by affecting chromatin organization and access of repair proteins to damaged sites, investigating these relationships may reveal important functions of nrm in genome stability .

How does nrm function compare across different Drosophila species?

Comparative analysis of nrm across Drosophila species provides evolutionary insights:

  • Sequence conservation analysis: Align nrm sequences from various Drosophila species to identify:

    • Highly conserved domains (likely functional cores)

    • Species-specific variations (potential adaptive features)

    • Selection signatures (indicating evolutionary constraints)

  • Expression pattern comparison: Examine whether tissue-specific expression is conserved across species, which would suggest conserved functional roles.

  • Functional complementation tests: Determine whether nrm from different species can rescue phenotypes in D. melanogaster nrm mutants.

This evolutionary perspective can identify essential functional domains that have been maintained throughout Drosophila evolution, similar to approaches used for other conserved proteins like Keap1/Nrf2 pathway components .

How can FlyBase resources be leveraged to enhance nrm research?

FlyBase provides extensive resources that can accelerate nrm research:

  • Gene and protein information: Access comprehensive annotations including gene structure, protein domains, and functional predictions for nrm .

  • Expression data integration: FlyBase now incorporates single-cell RNA sequencing data, allowing researchers to examine nrm expression across cell types and developmental stages .

  • Genetic tools: Identify available stocks with nrm mutations, RNAi constructs, or GAL4 drivers that can be used to manipulate nrm expression.

  • Orthology information: Explore relationships between Drosophila nrm and homologs in other species, including humans, to translate findings across model systems .

  • Literature integration: FlyBase curates published literature, providing a centralized resource for previous research relevant to nrm function.

Researchers should regularly check for FlyBase updates, as the database continually incorporates new genomic and functional information that may impact nrm research directions .

What are the most promising future directions for nrm research in Drosophila?

Several promising research directions for nrm in Drosophila include:

  • Role in aging and stress resistance: Investigating whether nrm influences longevity and stress tolerance, similar to the Keap1/Nrf2 pathway in Drosophila .

  • Function in DNA repair and genome integrity: Exploring potential contributions to DNA damage responses and repair pathway choice, building on established Drosophila DSB repair assays .

  • Nuclear-cytoplasmic transport regulation: Examining whether nrm affects the transport of specific proteins or RNAs across the nuclear envelope.

  • Tissue-specific functions: Using the GAL4-UAS system to investigate cell type-specific roles, particularly in tissues where nrm is highly expressed.

  • Interaction with nuclear lamina: Studying potential roles in nuclear mechanics and chromatin organization at the nuclear periphery.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.