Recombinant Drosophila melanogaster Octopamine receptor beta-2R (Octbeta2R)

Shipped with Ice Packs
In Stock

Description

Functional Role in Drosophila Physiology

Octβ2R is critical for regulating ovulation and reproductive fitness in Drosophila melanogaster. Key findings include:

  • Ovulation and Oviduct Function:
    Octβ2R mediates octopamine-induced relaxation of oviduct visceral muscles by elevating intracellular cAMP and activating downstream effectors (PKA and CaMKII) . Homozygous octβ2r mutants are sterile due to failed ovulation despite normal mating behavior .

  • Synaptic Growth Regulation:
    Octβ2R promotes synaptic growth in neuromuscular junctions, counterbalanced by the inhibitory Octβ1R .

  • Amitraz Toxicity Target:
    In parasitic mites (Varroa destructor), Octβ2R orthologs are the sole targets of the insecticide amitraz, which hyperactivates the receptor to induce lethal hyperactivity .

Recombinant Production and Applications

Recombinant Octβ2R is produced with ≥85% purity (SDS-PAGE verified) across multiple platforms :

Production SystemApplicationsPurity
E. coliStructural studies, antibody generation ≥85%
Baculovirus/Mammalian CellsFunctional assays (cAMP signaling) ≥85%
Cell-Free ExpressionHigh-throughput screening ≥85%

Signaling Mechanisms and Pathways

Octβ2R activates multiple downstream pathways:

  • Primary Pathway:
    Octβ2RGαsadenylyl cyclasecAMPPKA/CaMKIIMuscle relaxation\text{Octβ2R} \rightarrow \text{Gαs} \rightarrow \text{adenylyl cyclase} \rightarrow \text{cAMP} \rightarrow \text{PKA/CaMKII} \rightarrow \text{Muscle relaxation} .

  • Cross-Receptor Compatibility:
    Ectopic expression of Octβ1R in octβ2r mutants fully rescues ovulation, while Octβ3R and OAMB isoforms show partial efficacy .

Research Implications and Experimental Use

Recombinant Octβ2R is pivotal for:

  • Insecticide Development:
    Amitraz selectively targets Octβ2R in mites but spares honeybees, highlighting its potential for species-specific pest control .

  • Neuromodulation Studies:
    Optogenetic activation of Octβ2R-expressing neurons replicates amitraz-induced hyperlocomotion in Drosophila .

  • Reproductive Biology Tools:
    Antibodies against Octβ2R (e.g., Rabbit anti-Octβ2R) enable oviduct-specific protein localization studies .

Comparative Analysis with Related Receptors

ReceptorSignaling PathwayBiological RoleAmitraz Sensitivity
Octβ2RcAMP/PKA/CaMKIIOvulation, synaptic growth High
Octβ1RcAMP (inhibitory)Synaptic growth suppression Low
OAMBCa²⁺Partial oviduct regulation None

Future Directions

  • Structural Resolution: Cryo-EM studies of recombinant Octβ2R could elucidate ligand-binding dynamics .

  • Insecticide Optimization: Designing Octβ2R-selective agonists/antagonists may improve mite-specific targeting .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify your requirement during order placement. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
Octbeta2R; Octbeta2; CG33976; Octopamine receptor beta-2R; DmOct-beta-12; DmOct-beta-2R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-536
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Octbeta2R
Target Protein Sequence
MLLCDGLGPEPPRQRHRNRTSAARIRKRPKCCCGDGGSGNQAEQPGGIVSNPISYGQSLT TLARVTAAALTTAAMLHTTNALAATGSSSASNSSTGGIALPLGTATPATHELNATQPFGG SGLNFNESGAGLSDHHHHQQHNPDEDWLDNIVWVFKAFVMLLIIIAAICGNLLVIISVMR VRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLWNSLDVYFSTAS ILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQ QFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQEKQLMMRHGNAM LMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTF ILCWLPFFLWYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTL LCLFCNWWKDRHLPLDIDIRRSSLRYDQRAKSVYSESYLNSTTPSHRRQSQMVDNL
Uniprot No.

Target Background

Function
Octbeta2R is an autoreceptor for octopamine (OA), a neurotransmitter, neurohormone, and neuromodulator in invertebrates. It plays a crucial role in ovulation and fertilization. During ovulation, it mediates the OA-induced relaxation of the oviduct visceral muscles by increasing cAMP levels and activating effectors such as calmodulin-dependent kinase II (CaMKII) and cAMP-dependent protein kinase A (PKA) pathways. Octbeta2R positively regulates synaptic growth, an action antagonized by Octbeta1R.
Gene References Into Functions
  1. These observations suggest that Octbeta2R possesses distinct signaling capabilities in vivo and activates multiple signaling pathways to induce egg laying. PMID: 25099506
Database Links

KEGG: dme:Dmel_CG33976

STRING: 7227.FBpp0303153

UniGene: Dm.29778

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
In the adult, expressed in the superior protocerebrum and the optic lobe medulla of the central nervous system, nurse cells of egg chambers in the ovary at oogenic stages 1-10, and spermatogonia and spermatocytes in the testis. Expressed in the oviduct ep

Q&A

What is Octopamine receptor beta-2R and how does it function in Drosophila melanogaster?

Octopamine receptor beta-2R (Octbeta2R) is one of the β-adrenergic-like octopamine receptors in Drosophila melanogaster. It belongs to a family of G protein-coupled receptors that respond to octopamine, which is the invertebrate structural and functional analog of norepinephrine in vertebrates. Octopamine is synthesized from the amino acid tyrosine via the action of tyrosine decarboxylase (Tdc) and tyramine β-hydroxylase (TβH) .

When activated by octopamine, Octbeta2R stimulates adenylyl cyclases, resulting in increased intracellular cAMP levels . This signaling mechanism resembles that of vertebrate β-adrenergic receptors. The receptor plays crucial roles in regulating various physiological processes and behaviors, with particularly well-documented functions in reproductive behaviors. Studies have shown that Octbeta2R controls ovulation in D. melanogaster and is highly expressed in the fertilized female reproductive tract .

How does Octbeta2R differ from other octopamine receptors in Drosophila?

Drosophila melanogaster possesses several octopamine receptor subtypes that can be categorized based on their signaling mechanisms and pharmacological properties:

Receptor TypeSignaling MechanismPrimary FunctionsStructural Classification
Octα1R (Oamb)Increases Ca²⁺ from intracellular storesMemory, sleepα₁-adrenergic-like
Octα2RInhibits adenylyl cyclases, decreases cAMPLocomotion, grooming, starvation-induced hyperactivityα₂-adrenergic-like
Octβ1RStimulates adenylyl cyclases, increases cAMPVarious physiological functionsβ-adrenergic-like
Octβ2RStimulates adenylyl cyclases, increases cAMPReproduction, ovulationβ-adrenergic-like
Octβ3RStimulates adenylyl cyclases, increases cAMPDevelopment, pupationβ-adrenergic-like

Octbeta2R differs from other octopamine receptors primarily in its expression pattern and physiological roles. It is particularly notable for its high expression in the female reproductive tract and its well-established role in controlling ovulation, making it "the dominant subject of current research on insect OA receptors" . Unlike Octα2R, which inhibits adenylyl cyclases and decreases cAMP levels , Octbeta2R stimulates cAMP production. The receptor also differs from Octβ3R, which appears to be more involved in developmental processes such as pupation and ecdysone synthesis .

What are the pharmacological properties of Octbeta2R?

Octbeta2R exhibits distinct pharmacological properties that can be exploited for experimental manipulation:

Compound TypeExamplesEffect on Octbeta2REC₅₀/IC₅₀ Value Range
Endogenous AgonistsOctopamineFull agonist10⁻⁸-10⁻⁷ M
TyraminePartial agonist10⁻⁶-10⁻⁵ M
Synthetic AgonistsNaphazolineStrong agonistVariable by species
AntagonistsMetoclopramideAntagonistNot specified in sources
MianserinAntagonistNot specified in sources
PhentolamineAntagonistNot specified in sources

The pharmacological profile of Octbeta2R shows similarity to other β-adrenergic-like octopamine receptors but differs in sensitivity to specific ligands. Studies with related receptors have shown that octopamine sensitivity can vary between receptor subtypes, with EC₅₀ values ranging from 1.40 × 10⁻⁸ M to 8.68 × 10⁻⁷ M depending on the specific receptor and species . Octbeta2R antagonists like mianserin and phentolamine have been used experimentally to study receptor function, as they can affect physiological processes such as motility and reproduction in insects .

Where is Octbeta2R expressed in the Drosophila nervous system?

Octbeta2R shows broad but specific expression patterns within the Drosophila nervous system. While comprehensive expression maps are still being refined, studies using MiMIC-converted Trojan-Gal4 lines have provided valuable insights into its distribution:

The receptor is expressed in various brain regions, including the pars intercerebralis, which is a crucial brain region receiving projections from octopaminergic neurons and involved in locomotor activity control . Octbeta2R is also highly expressed in the female reproductive tract, particularly in the oviduct and spermatheca, consistent with its role in regulating ovulation .

Interestingly, similar to other octopamine receptors, Octbeta2R may be expressed in octopaminergic (Tdc2-positive) neurons themselves, suggesting the presence of autoreceptor mechanisms that allow octopamine to regulate its own release and signaling . This was demonstrated through co-expression studies using Tdc2 antibody labeling and genetic approaches with Tdc2-LexA drivers .

How can I visualize Octbeta2R expression in Drosophila tissues?

Researchers can employ several complementary techniques to visualize Octbeta2R expression patterns:

  • MiMIC-converted Trojan-Gal4 lines: These genetic tools allow for UAS-driven reporter expression (such as nuclear GFP) under the control of the endogenous Octbeta2R regulatory elements. This approach provides an accurate representation of the receptor's expression pattern .

  • Co-immunostaining: When studying potential co-expression with octopaminergic neurons, researchers can use antibodies against Tdc2 (the octopamine synthesis enzyme) alongside genetic reporters for Octbeta2R .

  • Intersectional genetic approaches: More refined expression patterns can be explored using intersectional methods, combining Octbeta2R-Gal4 with other cell-type specific drivers like Tdc2-LexA. This can be implemented with the UAS-FRT-stop-FRT-marker system, where expression of FLP recombinase under LexA control removes the stop cassette, allowing marker expression only in cells positive for both drivers .

  • MCFO (Multi-Color FlpOut) technique: This method can be used to label individual Octbeta2R-expressing neurons with different fluorescent markers, allowing for detailed morphological characterization of specific cells within broader expression domains .

A practical example of this approach is described in source , where researchers expressed a UAS-driven nuclear GFP reporter via individual octopamine receptor Gal4 lines and analyzed co-expression with Tdc2 using an antibody against this enzyme.

What behavioral and physiological processes does Octbeta2R regulate in Drosophila?

Octbeta2R plays integral roles in multiple behavioral and physiological processes in Drosophila:

FunctionDescriptionEvidence
ReproductionControls ovulation and egg-laying behaviorsHighly expressed in female reproductive tract; manipulations affect egg production
Exercise adaptationImproves endurance and speed when expressed in skeletal musclesExpression in skeletal muscles enhances performance metrics
NeuromodulationMay participate in broader octopaminergic regulation of behaviorsExpressed in diverse neuronal populations throughout the brain

The receptor's most well-characterized function relates to female reproduction. Octbeta2R is highly expressed in the fertilized female reproductive tract and controls ovulation in D. melanogaster . This role appears to be conserved across insect species, as interference with the orthologous receptor (N1Octβ2) in the brown planthopper (Nilaparvata lugens) similarly resulted in decreased egg production .

Beyond reproduction, Octbeta2R contributes to exercise adaptation. Research has shown that activation of specific octopamine receptors in skeletal and cardiac muscles is required for exercise adaptation, and expression of Octbeta2R in skeletal muscles improved endurance and speed in Drosophila .

What phenotypes are observed when Octbeta2R function is disrupted?

Disruption of Octbeta2R function through genetic or pharmacological approaches produces several observable phenotypes:

  • Reproductive deficits: Interference with Octbeta2R expression results in decreased egg production, reflecting its critical role in ovulation control . This has been demonstrated both in Drosophila and in other insect species like the brown planthopper, suggesting evolutionary conservation of this function.

  • Locomotor impairment: While some effects on locomotion may be attributed to other octopamine receptors like Octα2R (whose mutation decreases locomotor activity ), Octbeta2R also contributes to movement regulation, particularly in the context of exercise adaptation and muscle function.

  • Altered stress responses: Octopamine signaling broadly contributes to stress adaptation in insects, and Octbeta2R likely participates in mediating these responses, although specific effects have not been fully characterized.

  • Physiological disruptions: Pharmacological inhibition of Octbeta2R using antagonists like mianserin and phentolamine affects motility in insects , indicating its role in coordinating physiological responses.

How does Octbeta2R function differ between male and female Drosophila?

While the search results don't directly address sex differences in Octbeta2R function, several observations suggest sexually dimorphic roles:

Octbeta2R is prominently expressed in the female reproductive tract and plays a critical role in controlling ovulation and egg-laying behaviors . This suggests a female-specific function that would not be present in males. The high expression of Octbeta2R in the fertilized female reproductive tract further supports sex-specific functions .

Research has also shown that specific subsets of octopaminergic neurons that co-express Tdc2 (octopamine synthesizing enzyme) and dsx (doublesex, a sex-determination gene) project to distinct regions of the female reproductive tract, including the spermatheca, oviduct, uterus, and ovaries . This suggests that octopamine signaling through Octbeta2R may be integrated with sex-determination pathways to regulate female-specific behaviors.

In males, Octbeta2R might serve different physiological functions, possibly relating to male-specific behaviors such as courtship or aggression, though these roles are less well-characterized than the reproductive functions in females.

What genetic tools are available for studying Octbeta2R function in Drosophila?

Researchers studying Octbeta2R have access to several sophisticated genetic tools:

Genetic ToolDescriptionApplications
MiMIC-converted Trojan-Gal4 linesGAL4 driver reflecting endogenous Octbeta2R expressionVisualizing expression patterns; targeted manipulation of Octbeta2R-expressing cells
UAS-RNAi linesRNA interference constructs targeting Octbeta2RKnockdown of receptor expression in specific tissues
CRISPR/Cas9 systemGenome editing technology for targeted mutationsGeneration of knockout or knock-in alleles
FLP/FRT systemSite-specific recombination for mosaic analysisCreating tissue-specific receptor knockouts; MCFO labeling
Tdc2-LexADriver for octopaminergic neuronsIntersectional approaches to study Octbeta2R in octopamine circuits

The MiMIC-converted Trojan-Gal4 lines have proven particularly valuable for studying octopamine receptors. These lines are generated by converting Minos-Mediated Integration Cassette (MiMIC) insertions into Trojan-GAL4 gene traps, allowing for UAS-driven reporter expression that accurately reflects endogenous receptor expression patterns .

For functional studies, RNA interference approaches have been employed. Although RNAi efficiency can be variable in Lepidoptera, this approach has successfully revealed phenotypes associated with receptor knockdown . As noted in source , CRISPR/Cas9 technology offers an alternative approach for more comprehensive knockout studies.

Intersectional genetic approaches combining Octbeta2R-Gal4 with other drivers like Tdc2-LexA provide refined control over genetic manipulations, allowing researchers to target specific subpopulations of Octbeta2R-expressing cells .

What pharmacological agents can be used to manipulate Octbeta2R function?

Several pharmacological agents can be used to experimentally manipulate Octbeta2R function:

Agonists:

  • Octopamine: The endogenous ligand, activates the receptor with EC₅₀ values typically in the range of 10⁻⁸-10⁻⁷ M .

  • Tyramine: A precursor of octopamine that can also activate the receptor, though typically with lower potency than octopamine .

  • Naphazoline: A synthetic agonist that has shown strong activation of octopamine receptors in some insect species .

  • Epinephrine and norepinephrine: Vertebrate adrenergic ligands that can cross-activate insect octopamine receptors with varying efficacies .

Antagonists:

  • Mianserin: An antagonist that has been used to block octopamine receptor function in various insect species, affecting processes like motility .

  • Phentolamine: Another antagonist used in experimental studies of octopamine receptor function .

  • Metoclopramide: Has been identified as an antagonist for certain octopamine receptors .

When designing pharmacological experiments, researchers should consider potential interactions with other receptor types. For example, some ligands may also interact with tyramine receptors or other octopamine receptor subtypes with different affinities . Additionally, the efficacy of these compounds may vary between different insect species and receptor subtypes.

How can I perform electrophysiological recordings from Octbeta2R-expressing neurons?

Electrophysiological characterization of Octbeta2R-expressing neurons provides valuable insights into receptor function and neuronal properties. Based on the methodologies described in the search results, the following approach can be employed:

  • Preparation: Generate flies expressing fluorescent markers (such as mCD8-GFP) in Octbeta2R-expressing neurons using the appropriate Gal4 driver. For adult preparations, dissect the central nervous system in physiological saline solution .

  • Visualizing target neurons: Use fluorescence microscopy to identify GFP-labeled Octbeta2R-expressing neurons. Focus on anatomically consistent and readily identifiable cells for repeatability across experiments .

  • Whole-cell patch-clamp recordings: Apply whole-cell patch-clamp techniques to record from soma of labeled neurons. This approach allows measurement of both passive membrane properties and active firing characteristics .

  • Pharmacological manipulation: During recordings, apply octopamine or other receptor ligands to assess direct effects on neuronal excitability and membrane properties. Include appropriate controls with receptor antagonists to confirm specificity .

  • Analysis parameters: Analyze key electrophysiological parameters including resting membrane potential, input resistance, action potential threshold, firing frequency, and response to current injection .

Source describes a successful approach where researchers performed whole-cell patch-clamp recordings from Tdc2-positive octopaminergic cell bodies in the abdominal ganglion. They focused specifically on two large, consistently identifiable cell bodies at the posterior tip of a neuronal cluster, which were labeled using Tdc2-Gal4 driven mCD8-GFP expression . This methodological approach could be adapted for Octbeta2R-expressing neurons.

How do Octbeta2R splice variants affect receptor function and signaling properties?

Alternative splicing generates functionally distinct Octbeta2R variants with different signaling properties. While the search results don't specifically address Octbeta2R splice variants, they do provide insights from related octopamine receptors that likely apply:

The α2-adrenergic-like octopamine receptor gene (DmOctα2R) encodes two transcripts through alternative splicing. The long isoform (DmOctα2R-L) differs from the short isoform (DmOctα2R-S) by an additional 29 amino acids within the third intracellular loop . This structural difference translates to functional differences in ligand sensitivity—the long form exhibits greater sensitivity to ligands including octopamine, tyramine, epinephrine, and norepinephrine compared to the short form . Both variants inhibit cAMP production upon activation.

Similar alternative splicing mechanisms likely generate functional diversity in Octbeta2R signaling. Different splice variants may exhibit:

  • Varied sensitivity to endogenous ligands

  • Different coupling efficiency to downstream signaling pathways

  • Tissue-specific expression patterns

  • Distinct regulatory properties and desensitization kinetics

These differences could allow fine-tuning of octopamine signaling in different neuronal populations or physiological contexts, contributing to the versatility of octopaminergic modulation in Drosophila.

What is the evolutionary conservation of Octbeta2R structure and function across insect species?

Octbeta2R structure and function show considerable evolutionary conservation across insect species, though with species-specific adaptations:

Functional studies have demonstrated that orthologous β2-octopamine receptors in different insect species share core functions in regulating reproduction. For example, interference with N1Octβ2 in the brown planthopper (Nilaparvata lugens) resulted in decreased egg production, similar to the reproductive phenotypes observed with Octbeta2R manipulation in Drosophila . This suggests conservation of the receptor's role in controlling ovulation and reproduction.

The pharmacological properties of octopamine receptors also show similarities across species, though with quantitative differences in ligand sensitivity. For instance, comparison of the β3-octopamine receptor across species revealed that the Plutella xylostella receptor (PxOctβ3) was more sensitive to octopamine than the Tribolium castaneum receptor (TcOctβ3) but less sensitive than the Drosophila melanogaster receptor (DmOctβ3) . Similar variations likely exist for Octbeta2R across species.

Despite general conservation, species-specific adaptations in receptor function likely contribute to specialized behaviors and physiological processes. These adaptations may reflect evolutionary pressures related to different ecological niches and life-history strategies across insect taxa.

How does Octbeta2R interact with other neuromodulatory systems in Drosophila?

Octbeta2R functions within a complex network of interacting neuromodulatory systems in Drosophila:

  • Interaction with tyraminergic signaling: Tyramine, the biosynthetic precursor of octopamine, can activate Octbeta2R, though with lower potency than octopamine . This suggests functional interaction between octopaminergic and tyraminergic systems, with tyramine potentially modulating Octbeta2R signaling. Source notes that "tyramine can be involved in the fine-tuning of octopaminergic signaling," indicating cross-talk between these systems.

  • Co-regulation with serotonergic pathways: Some octopamine receptors show responsiveness to serotonin, as indicated by the title of source : "A new Drosophila octopamine receptor responds to serotonin." While this specifically refers to the α2-adrenergic-like octopamine receptor, similar cross-reactivity might exist for Octbeta2R, suggesting potential interaction between octopaminergic and serotonergic systems.

  • Autoreceptor mechanisms: Octbeta2R, like other octopamine receptors, may be expressed in octopaminergic (Tdc2-positive) neurons themselves . This suggests the presence of autoreceptor mechanisms that allow octopamine to regulate its own release and signaling, creating feedback loops within the octopaminergic system.

  • Integration with inhibitory neurotransmission: Research has identified GluCl (glutamate-gated chloride channel) expression in or near octopaminergic neurons, suggesting that glutamatergic inhibitory signaling may regulate octopamine neurons and thus indirectly affect Octbeta2R function .

These interactions create a complex regulatory network where Octbeta2R signaling is modulated by and modulates other neuromodulatory systems, contributing to the fine coordination of diverse physiological processes and behaviors in Drosophila.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.