Recombinant Drosophila melanogaster Odorant receptor 22b (Or22b)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant Or22b

Recombinant Or22b is produced by expressing the full-length Or22b gene (1–397 amino acids) in E. coli with an N-terminal His tag for purification . Key specifications include:

PropertyDetail
Gene NameOr22b (Synonyms: AN12, DOR22A.2, dor67, CG4231)
UniProt IDP81910
Protein Length397 amino acids
Expression SystemE. coli
Purity>90% (SDS-PAGE)
ApplicationsStructural studies, ligand-binding assays, functional characterization

The amino acid sequence includes conserved domains typical of insect ORs, such as transmembrane helices and extracellular loops critical for odorant binding .

Gene Context and Evolution

  • Or22b arose from a recent duplication event in the melanogaster subgroup, alongside its paralog Or22a . Both genes are co-expressed in the ab3A olfactory neurons but exhibit divergent evolutionary rates, with Or22b evolving faster at synonymous and nonsynonymous sites .

  • Unlike Or22a, Or22b is neither necessary nor sufficient for odor detection in ab3A neurons, suggesting subfunctionalization or neofunctionalization post-duplication .

Co-Receptor Interaction

  • Like other insect ORs, Or22b likely requires the co-receptor Orco (Odorant receptor co-receptor) for proper trafficking and function . This interaction stabilizes the receptor complex in sensory neuron cilia .

Functional Studies

  • Ligand Specificity: While Or22a responds broadly to esters and alcohols, Or22b’s ligands remain uncharacterized. Chimeric studies suggest ligand-binding determinants reside in the N-terminal region .

  • Behavioral Assays: Ectopic expression of Or22b in mutant neurons does not rescue odor responses, underscoring its auxiliary role .

Evolutionary Significance

  • Copy-number polymorphisms in the Or22a/Or22b locus exist in natural populations, with long (two-gene) and short (chimeric Or22ab) variants. The short variant shows higher nucleotide diversity, hinting at balancing selection .

  • In D. sechellia, Or22b has pseudogenized, reflecting species-specific adaptations .

Key Research Applications

Recombinant Or22b is utilized in:

ApplicationPurposeExample Study
Structural BiologyResolving receptor-ligand binding interfaces
Evolutionary AnalysisTracing gene duplication and divergence in Drosophila
Functional ScreeningIdentifying co-receptor dependencies (e.g., Orco)

Unresolved Questions

  • Ligand Profile: The specific odorants activating Or22b remain unidentified .

  • Regulatory Role: Whether Or22b modulates Or22a function or has independent signaling roles is unclear .

  • Population Genetics: The maintenance of Or22b polymorphisms in natural populations suggests cryptic adaptive value .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand that specific requirements may arise. Should you have a preferred format, kindly indicate it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Or22b; AN12; DOR22A.2; dor67; Or22A.2; CG4231; Odorant receptor 22b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-397
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or22b
Target Protein Sequence
MLSQFFPHIKEKPLSERVKSRDAFVYLDRVMWSFGWTVPENKRWDLHYKLWSTFVTLLIF ILLPISVSVEYIQRFKTFSAGEFLSSIQIGVNMYGSSFKSYLTMMGYKKRQEAKMSLDEL DKRCVCDEERTIVHRHVALGNFCYIFYHIAYTSFLISNFLSFIMKRIHAWRMYFPYVDPE KQFYISSIAEVILRGWAVFMDLCTDVCPLISMVIARCHITLLKQRLRNLRSEPGRTEDEY LKELADCVRDHRLILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTLSTGVAVV LFMSCVSMQTFPFCYLCNMIMDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIIL TAGGVFPISMQTNLNMVKLAFTVVTIVKQFNLAEKFQ
Uniprot No.

Target Background

Function
Odorant receptor 22b (Or22b) is a protein in Drosophila melanogaster that mediates acceptance or avoidance behavior in response to odor stimuli. The specific behavior elicited depends on the nature of the odorant. The odorant receptor repertoire encompasses a wide range of odor stimuli, varying in identity, intensity, and duration. Or22b is involved in the behavioral responses to esters. It forms complexes with Orco to create odorant-sensing units, enabling sensitive and prolonged odorant signaling and calcium permeability. These complexes are essential and sufficient to promote functional reconstitution of odor-evoked signaling in sensory neurons that typically respond only to carbon dioxide.
Gene References Into Functions
  1. Studies have revealed a generally more rapid evolutionary rate of the Or22b copy, affecting both synonymous and nonsynonymous sites. However, an excess of nonsynonymous substitutions was only observed in the early evolutionary history of this copy. PMID: 18922763
Database Links

KEGG: dme:Dmel_CG4231

STRING: 7227.FBpp0077542

UniGene: Dm.4820

Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or2a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed with Orco in 20-22 sensory neurons on the medial-proximal edge of the antenna. This expression pattern matches the distribution of the large sensilla basiconica. Expression is first seen at 60 hours APF in a subset of cells restricted to a subre

Q&A

What is Drosophila melanogaster Or22b and what is its function?

Or22b is a member of the odorant receptor (Or) gene family in Drosophila melanogaster that determines the response properties of olfactory receptor neurons (ORNs). Specifically, it is one of two gene copies (along with Or22a) found at the Or22 locus in many D. melanogaster strains including the laboratory Canton-S strain . The Or22 locus shows high levels of sequence divergence and copy number variation between D. melanogaster and other Drosophila species . In the olfactory system, Or22b is expressed in the ab3A olfactory receptor neurons . Functionally, Or22b contributes to odorant detection capabilities, though in some strains like Canton-S, Or22b protein is presumed nonfunctional while Or22a is responsible for ab3A responses . Interestingly, in other natural variants where Or22b is functional, it confers different ligand-binding properties to the ab3A neurons compared to Or22a, affecting olfactory-driven behaviors such as host-seeking and oviposition site preference .

How does Or22b compare structurally and functionally to other odorant receptors in Drosophila?

Or22b belongs to the large family of insect odorant receptors which function as ligand-gated ion channels. Structurally, Or22b and Or22a share 78% sequence identity, indicating they likely resulted from a relatively recent gene duplication . This high similarity is unusual compared to the Or family as a whole, which typically shows much greater sequence divergence between members. Functionally, different Or22b variants significantly alter the response profile of ab3A neurons compared to Or22a. While neurons expressing Or22a (ab3A-1 phenotype) respond strongly to ethyl hexanoate and other esters, neurons expressing functional Or22b variants show distinct response profiles with reduced sensitivity to some compounds and enhanced sensitivity to others, such as isopentyl acetate and propyl acetate . Unlike most conserved Drosophila ORNs, the ab3A neuron is one of few known to show significant interspecies variation between closely related Drosophila species, and even intraspecies variation within D. melanogaster populations . This makes Or22b particularly interesting for studying the evolution of olfactory coding and its adaptive significance.

What natural variants of Or22b have been identified and how do they differ?

Three main variants at the Or22 locus have been identified in D. melanogaster:

  • The "long allele" containing both Or22a and Or22b genes (as found in Canton-S lab strain) - In this variant, Or22a is functional while Or22b is presumed nonfunctional .

  • The "short allele" containing a chimeric Or22ab gene - This variant formed through a deletion that fused the N-terminus of Or22a with most of the Or22b sequence . The chimeric Or22ab receptor is functional and confers dramatically different ligand-binding properties compared to Or22a.

  • A variant with both Or22a and Or22b genes, but where Or22b is functional - This rare variant creates a third distinct ab3A response phenotype (ab3A-3) .

These variants differ in their amino acid sequences due to nonsynonymous SNPs. One critical mutation identified is R194M in Or22b, which restores functionality to the otherwise non-functional Or22b protein found in the Canton-S strain . The distribution of these variants shows potential clinal variation, with the short allele appearing at high frequency in northern Australia and the long allele being fully penetrant in southern Australia, suggesting possible selective pressures .

What expression systems are most effective for recombinant Or22b production?

For recombinant Or22b production, two main expression systems have proven effective depending on research goals:

  • E. coli expression system: Suitable for producing large quantities of recombinant Or22b protein for structural studies and antibody production. As evident in commercial preparations, E. coli can be used to express partial Or22b proteins with purities exceeding 85% as determined by SDS-PAGE . This system is advantageous for its scalability and cost-effectiveness, though proper protein folding may be challenging.

  • "Empty neuron" system in Drosophila: For functional studies, the "empty neuron" system where Or genes are expressed in Drosophila neurons lacking their endogenous receptors is highly effective . This in vivo expression system allows for electrophysiological measurements and behavioral testing of specific Or variants. Studies have demonstrated successful expression of Or22a, Or22ab, and various Or22b constructs in this system, enabling direct comparison of their functional properties .

When selecting an expression system, researchers should consider whether they need properly folded functional protein (favoring the empty neuron system) or higher protein yields (favoring bacterial expression). For structural biology applications, insect cell expression systems may offer advantages for proper folding and post-translational modifications, though this was not specifically mentioned in the provided sources.

How can electrophysiological recordings be optimized to characterize Or22b function?

Optimizing electrophysiological recordings for characterizing Or22b function requires several methodological considerations:

  • Neuron identification: Properly identify the ab3A neurons in Drosophila antennae through their morphological characteristics and positioning. These large-spiking neurons are found in ab3 sensilla and can be distinguished from neighboring neurons by spike amplitude .

  • Stimulus delivery: Precise odorant delivery systems using filtered air streams and calibrated odorant dilutions are essential. Studies examining Or22b function have used a range of esters (including ethyl hexanoate, methyl hexanoate, and various acetates) at defined concentrations to construct reliable dose-response curves .

  • Recording parameters: Single-sensillum recordings should be performed at controlled temperature and humidity. Spike sorting algorithms can help distinguish between co-localized neurons. Spontaneous activity should be recorded before and after stimulation to establish baseline activity.

  • Comparative approach: When testing Or22 variants, it's crucial to use isogenic lines with controlled genetic backgrounds or the empty neuron system to ensure that observed differences are due to the receptor variants rather than other genetic factors .

  • Data analysis: Response profiles should be analyzed across multiple odorants to generate comprehensive response spectra. Statistical comparisons between different Or22 variants should account for response variability and potential interaction effects between receptor type and odorant identity .

This methodology has successfully revealed significant functional differences between Or22a, Or22ab, and Or22b variants, particularly in their responses to esters like ethyl hexanoate and isopentyl acetate .

What are the recommended protocols for site-directed mutagenesis of Or22b for structure-function studies?

  • Target selection: Focus on amino acid positions that differ between functional and non-functional Or22b variants, or between Or22b and Or22a. Previous studies identified key residues like position R194M that restore functionality to non-functional Or22b protein .

  • Mutagenesis strategy: Design primers containing the desired mutations using overlapping PCR methods. For the Or22 locus, researchers have successfully created:

    • Point mutations (e.g., R194M, N92D, D201A)

    • Domain swaps (e.g., replacing the N-terminus of Or22b with that of Or22a)

    • Chimeric constructs (mimicking the natural Or22ab variant)

  • Expression system: For functional assessment, use the "empty neuron" system by expressing mutated constructs in the ab3A neuron of flies lacking endogenous Or22 genes. This allows direct electrophysiological testing of the mutant receptors' responses to odorants .

  • Validation: Sequence the mutated constructs to confirm successful mutagenesis. Control experiments should include testing wild-type Or22b alongside mutants under identical conditions, and testing multiple independent transformant lines to account for position effects .

  • Functional characterization: Test each mutant receptor against a panel of odorants that distinguish between different Or22 variants (e.g., ethyl hexanoate, isopentyl acetate, propyl acetate) to identify shifts in response profiles .

This approach has successfully identified critical amino acid positions that determine the functional differences between Or22 variants, such as the R194M substitution that converts a non-functional Or22b into a functional receptor .

How does population genetic variation at the Or22 locus influence olfactory-driven behaviors?

Population genetic variation at the Or22 locus has significant implications for olfactory-driven behaviors in D. melanogaster:

  • Oviposition preference: Flies carrying different Or22 variants show distinct oviposition site preferences. Those with the chimeric Or22ab allele demonstrate stronger preference for certain oviposition substrates (specifically banana) compared to flies with the long allele containing separate Or22a and Or22b genes . This behavioral difference may have adaptive significance as oviposition decisions directly impact offspring fitness.

  • Odorant preference: Transgenic flies expressing either Or22a or Or22ab in the empty neuron system show different attraction behaviors toward ethyl hexanoate, with Or22ab-expressing flies exhibiting greater attraction . This confirms that the receptor variants themselves, rather than linked genetic factors, contribute to behavioral differences.

  • Geographical distribution: The Or22 variants show clinal distribution in Australia, with the short (Or22ab) allele found at higher frequencies in northern regions and the long allele (separate Or22a and Or22b) predominant in southern regions . This pattern suggests selective pressure may be acting on this locus, potentially related to regional differences in available food sources or microbial communities.

  • Potential ecological significance: The different olfactory sensitivities conferred by Or22 variants may adapt flies to detect specific host fruits or their associated microbial communities that vary geographically . The altered sensitivity to fruit esters like ethyl hexanoate could influence food-seeking behavior in different environments.

These findings suggest that natural selection may be acting on the Or22 locus to optimize olfactory detection based on local ecological conditions, representing a potential case of local adaptation in sensory systems .

What methodological approaches can resolve contradictory data on Or22b functionality?

Resolving contradictory data on Or22b functionality requires systematic multi-level approaches:

  • Genetic background control: Ensure isogenic backgrounds when comparing Or22 variants to eliminate confounding genetic effects. Previous studies successfully isolated the effects of Or22 variation by creating isogenic lines from wild populations and confirming genotypes through molecular characterization .

  • Molecular characterization matrix:

    • Sequence analysis of all Or22 variants to identify specific polymorphisms

    • Transcript expression verification using RT-PCR and qPCR

    • Protein expression confirmation using immunohistochemistry

    • Assessment of receptor trafficking to dendritic membranes

  • Functional validation through multiple systems:

    • Heterologous expression in "empty neuron" systems

    • Transgenic rescue experiments

    • CRISPR/Cas9 gene editing to introduce specific mutations

    • Cross-species comparison of orthologous receptors

  • Multi-level phenotypic assessment:

    • Electrophysiological recordings from individual neurons

    • Calcium imaging of glomerular responses

    • Behavioral assays testing multiple olfactory-dependent behaviors (attraction, oviposition, learning)

  • Statistical rigor:

    • Adequate sample sizes with appropriate power analysis

    • Blinded experimental design

    • Appropriate statistical tests for comparing response profiles

    • Consideration of interaction effects between receptor variants and odorants

This comprehensive approach has successfully resolved apparent contradictions by identifying specific amino acid substitutions that determine Or22b functionality, such as the R194M mutation that converts non-functional Or22b to a functional receptor . Additionally, it has connected molecular variation to neuronal response differences and ultimately to behavioral outcomes .

How can computational modeling be used to predict ligand interactions with Or22b variants?

Computational modeling offers powerful approaches for predicting ligand interactions with Or22b variants:

  • Homology modeling: While no crystal structure for insect odorant receptors was mentioned in the provided sources, homology models based on distantly related proteins with similar transmembrane topology could provide initial structural insights. These models can incorporate the known amino acid differences between Or22a, Or22b, and Or22ab to predict structural consequences.

  • Molecular docking simulations: Using known ligands of Or22 variants (ethyl hexanoate, isopentyl acetate, etc.), docking simulations can predict binding modes and binding energies. This approach would be particularly valuable for understanding how specific mutations like R194M in Or22b alter ligand binding profiles .

  • Molecular dynamics simulations: For key ligand-receptor pairs, molecular dynamics simulations can reveal:

    • Conformational changes upon ligand binding

    • Stability of ligand-receptor complexes

    • Effects of specific amino acid substitutions on binding pocket structure

    • Potential allosteric effects of mutations

  • Structure-activity relationship (SAR) analysis: By correlating the chemical properties of known ligands with their experimentally determined activation potencies, computational models can identify chemical features critical for Or22b activation. This can help predict responses to novel compounds not yet tested experimentally.

  • Integration with experimental data: Models should be validated and refined using:

    • Experimentally determined response profiles from electrophysiology

    • Mutagenesis data identifying functionally important residues

    • Competition assays between ligands to identify binding site overlap

While the provided sources don't explicitly mention computational modeling approaches for Or22b, these methods have been successfully applied to other olfactory receptors and would be valuable for understanding the molecular basis of the functional differences observed between Or22 variants.

What are the major challenges in purification of functional recombinant Or22b protein?

Purification of functional recombinant Or22b protein presents several significant challenges:

  • Membrane protein solubility: As an integral membrane protein with multiple transmembrane domains, Or22b is inherently hydrophobic and difficult to solubilize while maintaining native conformation. While the commercial recombinant Or22b product is described as "partial" , suggesting it may not represent the full-length functional protein, researchers working with the complete receptor would need to optimize detergent conditions (e.g., DDM, LMNG, or amphipol) for extraction from membranes.

  • Protein stability: Odorant receptors tend to be unstable once removed from their native membrane environment. For handling recombinant Or22b, storage recommendations include adding 5-50% glycerol to the final concentration and aliquoting for long-term storage at -20°C/-80°C to prevent repeated freeze-thaw cycles . The shelf life for liquid preparations is typically 6 months at these temperatures, while lyophilized forms can last 12 months .

  • Functional validation: Confirming that purified Or22b retains ligand-binding capability is challenging outside cellular contexts. While the search results don't specifically address functional assays for purified Or22b, potential approaches include:

    • Isothermal titration calorimetry with known ligands

    • Surface plasmon resonance to detect ligand binding

    • Fluorescent ligand binding assays

    • Reconstitution into artificial membrane systems for electrophysiological measurements

  • Yield and purity: While commercial recombinant Or22b preparations achieve >85% purity by SDS-PAGE , higher purity (>95%) would be required for structural studies. Affinity tags (likely employed but not specified in the available information ) and multi-step chromatography can improve purity but may reduce yield.

  • Post-translational modifications: If D. melanogaster Or22b undergoes critical post-translational modifications, E. coli expression systems may not reproduce these modifications, potentially affecting function. Insect cell expression systems might be necessary for proper modification, though this would add complexity and cost.

How can researchers differentiate between Or22a and Or22b expression and function in experimental systems?

Differentiating between Or22a and Or22b expression and function requires specialized methodological approaches:

  • Sequence-specific nucleic acid detection:

    • RT-PCR with primers targeting unique regions of each transcript

    • In situ hybridization with probes designed to distinguish between the 78% identical Or22a and Or22b sequences

    • Single-molecule FISH for cellular co-expression analysis

    • qPCR for quantitative comparison of expression levels

  • Protein-level differentiation:

    • Generation of antibodies targeting unique epitopes in Or22a versus Or22b

    • Epitope tagging of receptors in transgenic systems (e.g., FLAG-Or22a vs. HA-Or22b)

    • Mass spectrometry identification of receptor-specific peptides

  • Functional discrimination:

    • Expression of individual receptors in the "empty neuron" system to isolate their response properties

    • Comparison of response profiles to discriminating odorants (e.g., ethyl hexanoate elicits strong responses from Or22a but weaker responses from functional Or22b variants)

    • Dose-response analysis across multiple odorants to generate receptor-specific "fingerprints"

  • Genetic approaches:

    • CRISPR/Cas9 knockout of individual receptors

    • Receptor-specific RNAi knockdown

    • Rescue experiments with individual receptors in Or22-null backgrounds

  • Computational methods:

    • Analysis of receptor-specific binding pockets based on sequence differences

    • Prediction of differential ligand interactions based on known response differences

Studies have successfully employed several of these approaches, particularly expressing individual receptors in the empty neuron system and comparing electrophysiological responses to panels of odorants . This methodology conclusively demonstrated that Or22a and functional Or22b variants confer distinct response profiles to ab3A neurons .

What quality control measures are essential for ensuring reproducible results in Or22b functional studies?

Ensuring reproducible results in Or22b functional studies requires comprehensive quality control measures:

  • Genetic verification:

    • Sequence confirmation of Or22 locus in all experimental lines

    • Verification of transgene insertion and copy number

    • Confirmation of genotype stability across generations

    • PCR verification of the presence of either separate Or22a/Or22b genes or the chimeric Or22ab gene

  • Expression validation:

    • RT-PCR or qPCR confirmation of proper transcript expression

    • Immunohistochemistry to verify protein localization in dendrites

    • Western blot to confirm protein size and expression levels

  • Electrophysiological recording standardization:

    • Consistent electrode properties and placement

    • Standardized odorant delivery systems with calibrated concentrations

    • Control recordings from known receptor genotypes (e.g., Canton-S as reference)

    • Inclusion of standard odorants as positive controls (e.g., ethyl hexanoate for Or22a function)

  • Biological and technical replication:

    • Multiple independent transgenic lines for each construct

    • Recordings from multiple flies within each genotype

    • Testing across different days and environmental conditions

    • Analysis of different neuron populations within individual flies

  • Data analysis rigor:

    • Blinded analysis procedures

    • Standardized spike sorting algorithms

    • Appropriate statistical comparisons between receptor variants

    • Dose-response analyses rather than single-concentration testing

  • Reagent quality:

    • Verification of odorant purity by GC-MS

    • Fresh preparation of volatile stimuli

    • Consistent preparation of recombinant proteins

    • Validated antibody specificity

These quality control measures have enabled researchers to confidently attribute functional differences to specific Or22 variants and identify key amino acid residues that determine receptor functionality, such as the R194M substitution in Or22b .

How might CRISPR/Cas9 genome editing advance our understanding of Or22b function in vivo?

CRISPR/Cas9 genome editing offers transformative approaches to understanding Or22b function in vivo:

This approach would significantly advance our understanding of how natural variation at the Or22 locus influences olfactory perception and behavior, potentially revealing mechanisms of sensory system evolution and adaptation to different ecological niches .

What unresolved questions remain about the evolutionary significance of Or22b variants?

Several critical questions remain unresolved regarding the evolutionary significance of Or22b variants:

  • Selective pressures: While clinal variation in Australia suggests selection may be acting on the Or22 locus , the specific selective pressures remain unclear:

    • Are changes in oviposition preference directly adaptive in different environments?

    • Do different geographic regions contain fruits or microbes that make different Or22 variants advantageous?

    • Is the Or22 locus under direct selection or is it in linkage disequilibrium with other adaptive loci?

  • Molecular evolution dynamics:

    • What is the ancestral state of the Or22 locus in Drosophila?

    • Do the forces of balancing selection, directional selection, or genetic drift predominantly shape Or22 variation?

    • What is the age of the different variants and their geographical origins?

    • How frequently do new functionally distinct variants arise through mutation, recombination, or gene conversion?

  • Functional tradeoffs:

    • Do the different Or22 variants represent adaptive specialization for detecting different odorants?

    • Is there a sensitivity-specificity tradeoff between variants?

    • What ecological conditions favor having two separate genes versus a chimeric gene?

    • Why do some strains maintain a non-functional Or22b copy?

  • Population-level consequences:

    • How does the distribution of Or22 variants correlate with host preference across global D. melanogaster populations?

    • Do Or22 variants contribute to reproductive isolation between populations?

    • How does Or22 variation interact with other olfactory receptor variations to shape the complete olfactome?

  • Cross-species comparisons:

    • How does Or22 variation within D. melanogaster compare to differences between closely related Drosophila species?

    • Do similar molecular mechanisms drive evolutionary changes in other olfactory receptors?

    • Are there convergent evolutionary patterns in other insect olfactory systems?

Addressing these questions would provide deeper insights into how sensory systems evolve and adapt to different ecological niches, potentially revealing fundamental principles about the genetic basis of behavioral evolution .

How can integration of multi-omics data enhance our understanding of Or22b in the broader olfactory system context?

Integration of multi-omics data offers comprehensive insights into Or22b function within the broader olfactory system context:

  • Transcriptomics integration:

    • Single-cell RNA-seq can reveal co-expression patterns between Or22b and other genes in ab3A neurons

    • Comparative transcriptomics across Or22 variants may identify compensatory gene expression changes

    • Temporal expression profiling during development can elucidate regulatory mechanisms

    • RNA-seq of flies with different Or22 variants under various ecological conditions could reveal context-dependent expression patterns

  • Proteomics applications:

    • Protein interaction networks could identify Or22b binding partners beyond Orco (the olfactory co-receptor)

    • Post-translational modification profiling might reveal regulatory mechanisms

    • Quantitative proteomics across tissues could map the complete protein context of Or22b function

    • Structural proteomics approaches could inform receptor structure-function relationships

  • Metabolomics contributions:

    • Profiling of odor-induced metabolic changes in antenna

    • Characterization of endogenous ligands that might modulate receptor function

    • Identification of metabolic differences in fruits preferred by flies with different Or22 variants

  • Connectomics insights:

    • Mapping of neural circuits downstream of ab3A neurons for different Or22 variants

    • Comparison of glomerular connectivity patterns in the antennal lobe

    • Tracing of information flow from peripheral detection to behavioral output

  • Comparative genomics:

    • Population genomics to identify selective sweeps around the Or22 locus

    • Cross-species comparisons to track evolutionary trajectories

    • Analysis of regulatory element conservation or divergence

  • Integration with the DoOR database:

    • Incorporation of Or22 variant response data into the comprehensive DoOR mapping of Drosophila odorant responses

    • Computational modeling of how Or22 variation affects the complete olfactome

    • Prediction of behavioral consequences based on altered information processing

This multi-omics integration would transform our understanding of Or22b from a single receptor variant to a key component in a complex, interconnected system, providing insight into how molecular variation propagates through cellular, circuit, and behavioral levels .

Data Table: Functional Properties of Or22 Variants

Or22 VariantReceptor StructureFunctionality StatusPrimary LigandsSecondary LigandsNeural Response PhenotypeAssociated Behaviors
Or22aSingle gene productFunctionalEthyl hexanoate (strong), Methyl hexanoate, Ethyl 2-methyl butanoateVarious esters and alcoholsab3A-1Moderate attraction to ethyl hexanoate, No strong oviposition preference
Or22b (Canton-S)Single gene productNon-functionalN/AN/ANo response when expressed aloneN/A
Or22abChimeric (Or22a N-terminus + Or22b sequence)FunctionalIsopentyl acetate, Butyl acetate, Propyl acetateReduced response to ethyl hexanoateab3A-2Stronger attraction to ethyl hexanoate, Strong preference for banana as oviposition substrate
Or22b (functional variant)Single gene product with R194M mutationFunctionalSimilar to Or22abSimilar to Or22abab3A-3Not specifically tested

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.