Recombinant Drosophila melanogaster Odorant receptor 23a (Or23a)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

The recombinant Or23a protein is synthesized in E. coli and purified via immobilized metal affinity chromatography (IMAC) using its His tag. Key steps include:

  • Vector Design: The Or23a gene is cloned into an expression vector optimized for bacterial systems.

  • Induction: Protein expression is induced using IPTG.

  • Solubility: The protein is extracted under denaturing conditions due to its transmembrane nature.

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) for stability .

Functional Role in Olfaction

Or23a functions as a ligand-gated ion channel when co-expressed with the odorant receptor co-receptor (Orco) in olfactory sensory neurons (OSNs) . This partnership enables:

  • Odorant Binding: Specific interaction with volatile compounds.

  • Signal Transduction: Activation of cation channels upon ligand binding, depolarizing OSNs .

  • Neuronal Specificity: Or23a defines the odor response profile of a single OSN class, akin to Or43b’s role in ab8A neurons .

Research Applications

Recombinant Or23a is primarily used for:

  • Ligand Screening: Identifying odorants that activate or inhibit the receptor.

  • Structural Studies: Analyzing transmembrane domain interactions via cryo-EM or X-ray crystallography.

  • Functional Assays: Reconstituting receptor activity in heterologous systems (e.g., HEK293 cells) .

Limitations and Challenges

  • Low Solubility: Requires denaturing conditions for purification, complicating structural studies .

  • Co-receptor Dependency: Requires Orco for proper trafficking and function, limiting standalone assays .

Comparative Insights from Related Receptors

Studies on Or43b (a paralog) reveal that:

  • Odorant receptors are essential for neuronal responsiveness (Or43b mutants lack odor-evoked activity in ab8A neurons) .

  • Functional redundancy exists in the olfactory system; single receptor knockouts may not abolish behaviors .

These findings suggest Or23a likely follows similar principles, though direct in vivo behavioral data remain unpublished.

Future Directions

  • Mechanistic Studies: Elucidate how Or23a discriminates between ligands.

  • In Vivo Validation: Generate Or23a mutants to assess its role in fly behavior.

  • Therapeutic Exploration: Engineer odorant receptors for biosensor applications .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in your order notes, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
Or23a; AN5; DOR23A.1; dor64; Or23A.1; CG9880; Odorant receptor 23a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-379
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or23a
Target Protein Sequence
MKLSETLKIDYFRVQLNAWRICGALDLSEGRYWSWSMLLCILVYLPTPMLLRGVYSFEDP VENNFSLSLTVTSLSNLMKFCMYVAQLTKMVEVQSLIGQLDARVSGESQSERHRNMTEHL LRMSKLFQITYAVVFIIAAVPFVFETELSLPMPMWFPFDWKNSMVAYIGALVFQEIGYVF QIMQCFAADSFPPLVLYLISEQCQLLILRISEIGYGYKTLEENEQDLVNCIRDQNALYRL LDVTKSLVSYPMMVQFMVIGINIAITLFVLIFYVETLYDRIYYLCFLLGITVQTYPLCYY GTMVQESFAELHYAVFCSNWVDQSASYRGHMLILAERTKRMQLLLAGNLVPIHLSTYVAC WKGAYSFFTLMADRDGLGS
Uniprot No.

Target Background

Function
This odorant receptor mediates acceptance or avoidance behavior in Drosophila melanogaster, depending on its substrates. The odorant receptor repertoire constitutes a wide range of odor stimuli varying in identity, intensity, and duration. Or23a may form a complex with Orco, forming odorant-sensing units, enabling sensitive and prolonged odorant signaling and calcium permeability.
Gene References Into Functions
  1. The or23a neuron primarily projects into the glomeruli of DL4 and DA4, with minor projections into DL5/1. PMID: 12555270
Database Links

KEGG: dme:Dmel_CG9880

STRING: 7227.FBpp0077382

UniGene: Dm.21525

Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or2a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in 10-40 sensory cells in the third antenna segment and in the maxillary palp.

Q&A

What is Drosophila melanogaster Odorant receptor 23a (Or23a) and where is it expressed in the fly?

Drosophila melanogaster Odorant receptor 23a (Or23a) is a full-length protein comprising 379 amino acids that functions as an olfactory receptor in the fruit fly's olfactory system. It belongs to the OR family of olfactory receptors, one of the two main olfactory receptor families in Drosophila .

To conclusively determine the expression pattern, researchers typically use:

  • In situ hybridization with Or23a-specific probes

  • Immunohistochemistry with anti-Or23a antibodies

  • GAL4-UAS reporter systems with the Or23a promoter

  • Single-cell RNA sequencing of olfactory sensory neurons (OSNs)

What methodologies are used to characterize the odorant response profile of Or23a?

Several complementary approaches can be employed to characterize Or23a's response profile:

Electrophysiological Methods:

  • Single Sensillum Recordings (SSRs) from native at2/ai2 sensilla

  • Ectopic expression of Or23a in "empty neuron" systems followed by SSR

  • Whole-cell patch clamp recordings in heterologous expression systems

Functional Imaging Methods:

  • Calcium imaging using GCaMP or other calcium indicators

  • Voltage imaging with genetically encoded voltage indicators

  • FRET-based sensors for monitoring conformational changes

Behavioral Assays:

  • T-maze olfactory preference assays with Or23a mutants vs. controls

  • Flight trajectory tracking in response to Or23a-specific odorants

  • Proboscis extension reflex (PER) assays to measure appetitive responses

When characterizing odorant responses, researchers typically test panels of up to 100 diverse odorants, though computational approaches have expanded this to include simulations with up to 240,000 compounds .

How does the tuning breadth of Or23a compare to other Drosophila olfactory receptors in the DoOR database?

The DoOR (Database of Odorant Responses) project provides a comprehensive resource for comparing olfactory receptor tuning profiles. While specific lifetime kurtosis (LTK) values for Or23a are not explicitly provided in the available search results, we can contextualize its tuning breadth relative to other receptors.

The DoOR project uses lifetime kurtosis (LTK) as a measure of receptor tuning breadth, with higher values indicating more narrowly tuned receptors . For context, the DoOR database reveals:

Narrowly Tuned Receptors (High LTK):

  • Or82a: LTK = 63.88 (narrowly tuned to geranyl acetate)

  • ac2A: LTK = 39.12 (narrowly tuned to putrescine)

  • Or49b: LTK = 35.87 (narrowly tuned to 2-, 3-, and 4-methylphenol)

  • Gr21a.Gr63a: LTK = 23.57 (specifically activated by CO₂)

  • ab2B: LTK = 20.9 (tuned to ethyl 3-hydroxybutyrate and cyclohexanol)

Broadly Tuned Receptors (Low LTK):

  • ab4B: LTK = -1.53

  • ac3B: LTK = -0.92

  • Or35a: LTK = -0.44

  • Or69a: LTK = -0.26

  • Or85f: LTK = 0.17

To determine where Or23a falls on this spectrum, researchers should:

  • Access the latest DoOR dataset (http://neuro.uni.kn/DoOR)

  • Compare response profiles across multiple odorants

  • Calculate the LTK value if Or23a has responses to at least 50 different odorants

  • Plot Or23a's response profile alongside known narrowly and broadly tuned receptors

What methodological approaches can resolve contradictory data about Or23a sensillum classification?

The conflicting nomenclature regarding Or23a's sensillum classification (trichoid at2 vs. intermediate ai2) represents a methodological challenge in the field . To resolve this contradiction, researchers can employ:

Morphological Characterization:

  • Scanning electron microscopy (SEM) with high-resolution imaging of sensillum morphology

  • Transmission electron microscopy (TEM) to examine internal ultrastructure

  • Morphometric analysis comparing sensillum length, diameter, and wall thickness against established trichoid and intermediate sensilla characteristics

Molecular Profiling:

  • Single-cell RNA sequencing of Or23a-expressing neurons to identify co-expressed genes

  • Dual-color fluorescent in situ hybridization to simultaneously visualize Or23a with trichoid-specific or intermediate-specific markers

  • Immunohistochemical co-labeling with antibodies against Or23a and known sensillum-type specific proteins

Functional Comparison:

  • Electrophysiological characterization comparing response properties of Or23a-expressing neurons with typical trichoid and intermediate sensilla

  • Cross-comparison of odorant response profiles using the DoOR database framework

Developmental Analysis:

  • Lineage tracing of Or23a-expressing neurons during development

  • Comparison of transcription factor requirements for Or23a expression versus known trichoid and intermediate sensilla

A comprehensive approach incorporating multiple lines of evidence would provide the most definitive resolution to this classification contradiction.

How can heterologous expression systems be optimized for functional characterization of Or23a?

Functional characterization of Drosophila olfactory receptors in heterologous systems presents several challenges that require methodological optimization:

Expression System Selection:

Expression SystemAdvantagesLimitationsOr23a-Specific Considerations
Xenopus oocytesHigh protein expression, established electrophysiology methodsLimited throughput, not native membrane environmentCo-expression with Orco required for functionality
HEK293T cellsMammalian post-translational modifications, suitable for imagingLower expression of insect receptorsOptimization of codon usage for mammalian expression
Sf9 insect cellsNative-like membrane environment, high expressionMore complex maintenanceBetter trafficking of Or23a to membrane
Empty neuron system (Δhalo)Native neuronal environmentLimited to electrophysiologyMost physiologically relevant but lower throughput

Optimization Strategies:

  • Co-receptor Expression:

    • Co-express Or23a with Orco (Or83b), the essential co-receptor for OR family function

    • Optimize Or23a:Orco ratio (typically 1:1 to 1:5) for maximum functional expression

  • Construct Design:

    • Add N-terminal signal sequences to enhance membrane targeting

    • Include epitope tags (e.g., FLAG, V5) for expression monitoring without interfering with function

    • Create fusion proteins with fluorescent reporters (separated by self-cleaving 2A peptides) to confirm expression

  • Culture Conditions:

    • Lower temperature incubation (18-28°C) to improve proper folding

    • Chemical chaperones (e.g., DMSO, glycerol) to enhance functional expression

    • Addition of sodium butyrate to increase expression in mammalian cells

  • Functional Assay Selection:

    • Calcium imaging with Fluo-4 or GCaMP for high-throughput screening

    • Patch-clamp electrophysiology for detailed kinetic analysis

    • Resonance energy transfer assays for monitoring conformational changes

What computational models best predict ligand binding to Or23a?

Computational modeling of odorant-receptor interactions provides valuable insights for understanding Or23a function. Several modeling approaches can be employed:

Homology Modeling:
Since the crystal structure of insect ORs remains unresolved, homology modeling using related proteins as templates represents a critical first step. Recent cryo-EM structures of insect Orco can serve as partial templates for modeling the Or23a-Orco complex.

Molecular Docking:

  • Prepare a library of potential Or23a ligands based on DoOR database information

  • Generate multiple receptor conformations to account for protein flexibility

  • Perform virtual screening using algorithms such as AutoDock Vina or GLIDE

  • Rank compounds based on predicted binding energies and interaction patterns

Molecular Dynamics Simulations:

  • Embed the Or23a-Orco complex in a simulated lipid bilayer

  • Perform long-timescale (>100 ns) simulations with and without bound ligands

  • Analyze conformational changes, binding site dynamics, and key ligand-receptor interactions

  • Calculate binding free energies using methods like MM-PBSA or FEP

Machine Learning Approaches:

  • Train models using known Or23a ligands from the DoOR database

  • Apply quantitative structure-activity relationship (QSAR) models to predict novel ligands

  • Implement deep learning architectures such as graph neural networks to capture complex chemical features

  • Validate predictions experimentally using electrophysiology or calcium imaging

The DoOR project has previously used computational approaches to predict responses to up to 240,000 odorants, which were partially validated by functional assays . Similar methodologies could be applied specifically to Or23a.

How do Or23a responses integrate into the broader olfactory coding strategy of Drosophila?

Understanding how Or23a contributes to olfactory coding requires consideration of its role within the larger sensory network:

Network Position Analysis:
Or23a-expressing neurons project to specific glomeruli in the antennal lobe. Mapping these projections through techniques like photoactivatable GFP expression or transsynaptic tracing reveals how Or23a information is anatomically integrated with other olfactory inputs.

Combinatorial Coding Assessment:
The DoOR project highlights the debate between labeled-line coding (via narrowly tuned receptors) and combinatorial coding (via broadly tuned receptors) . To determine Or23a's role:

  • Compare Or23a's response profile breadth with other receptors in the DoOR database

  • Identify odorants that activate multiple receptors including Or23a

  • Examine temporal dynamics of Or23a responses relative to other receptors

Information Theoretic Analysis:
Calculate mutual information between Or23a activity and:

  • Individual odorant identity

  • Odorant chemical classes

  • Behavioral relevance categories (food, danger, mating)

Integration with Higher Brain Centers:
Trace Or23a-derived information flow to:

  • Mushroom body (learning and memory)

  • Lateral horn (innate behaviors)

  • Superior protocerebrum (multimodal integration)

Understanding these connections reveals how Or23a participates in both innate and learned olfactory behaviors.

The DoOR project notes that even receptors that appear specialized for particular odorants may participate in combinatorial coding at higher concentrations, suggesting that Or23a might have multiple functional modes depending on stimulus intensity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.