Recombinant Drosophila melanogaster Odorant receptor 33c (Or33c)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Olfaction and Pheromone Detection

Or33c is implicated in detecting species-specific chemical cues, including pheromones:

Key Findings

  • Pheromone Specificity: Or33c exhibits weak responses to general odorants but strong selectivity for unidentified pheromonal compounds, likely cuticular hydrocarbons (CHs) .

  • Sexual Dimorphism: Expression levels are significantly higher in males than females (P < 0.01), suggesting a role in male-specific behaviors like mate recognition .

  • Co-receptor Dependency: Requires Orco (Or83b) for dendritic localization and ion channel function .

Evolutionary and Population Genetic Insights

Or33c shows signatures of positive selection across Drosophila species:

AnalysisResult
McDonald-Kreitman TestElevated replacement-to-silent (R/S) ratios in Or33c vs. Or33a/b (P < 0.05)
Nucleotide Diversity (π)Higher in African populations (π = 0.024) vs. non-African (π = 0.014)
Linkage DisequilibriumStronger in non-African populations, indicating recent selective sweeps

These patterns suggest adaptive evolution driven by ecological or sexual selection pressures .

Biochemical and Pharmacological Data

Recombinant Or33c is utilized in ligand screening and structural studies:

Ligand Response Profile

OdorantResponse IntensityProposed Role
2-HeptanoneModerate General odorant detection
Ethyl hexanoateWeak Fruit-associated volatile detection
Putative CH pheromonesStrong Species recognition and mating behaviors

Calmodulin Interaction

A conserved calmodulin (CaM)-binding site in Orco (e.g., K339N mutation) reduces Or33c-mediated responses by 40–60%, highlighting CaM’s role in sensitization .

Applications in Research and Technology

Recombinant Or33c is commercially available (e.g., Creative BioMart, Cusabio) for:

  • ELISA-Based Screens: Quantifying ligand-binding affinity .

  • Evolutionary Studies: Comparing orthologs in D. suzukii (82.2% amino acid identity) and D. virilis .

  • Neurogenetics: Investigating odor-guided behaviors via Or33c mutants .

Open Questions and Future Directions

  • Ligand Identification: The specific pheromone(s) detected by Or33c remain unknown .

  • Structural Mechanisms: How Or33c-Orco complexes gate ion channels is unresolved .

  • Ecological Relevance: Field studies are needed to link genetic variation to habitat adaptation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please specify it in your order and we will prioritize fulfilling your request.
Synonyms
Or33c; AN2; DOR33B.3; dor71; Or33B.3; CG5006; Odorant receptor 33c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or33c
Target Protein Sequence
MVIIDSLSFYRPFWICMRLLVPTFFKDSSRPVQLYVVLLHILVTLWFPLHLLLHLLLLPS TAEFFKNLTMSLTCVACSLKHVAHLYHLPQIVEIESLIEQLDTFIASEQEHRYYRDHVHC HARRFTRCLYISFGMIYALFLFGVFVQVISGNWELLYPAYFPFDLESNRFLGAVALGYQV FSMLVEGFQGLGNDTYTPLTLCLLAGHVHLWSIRMGQLGYFDDETVVNHQRLLDYIEQHK LLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSYMLFFVGDTISLVYYLVFFGVVCVQLF PSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLLIFTQLTLGNRGWIIKAGGLIELN LNAFFATLKMAYSLFAVVVRAKGI
Uniprot No.

Target Background

Function
Odorant receptor 33c (Or33c) is a receptor in *Drosophila melanogaster* that mediates acceptance or avoidance behavior based on its substrates. The odorant receptor repertoire comprises a diverse collection of odor stimuli varying in identity, intensity, and duration. Or33c may form a complex with Orco to create odorant-sensing units, enabling sensitive and prolonged odorant signaling and calcium permeability.
Database Links

KEGG: dme:Dmel_CG5006

UniGene: Dm.26797

Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or2a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the antenna and in a subset of 18 olfactory receptor neurons in the maxillary palp.

Q&A

How should recombinant Or33c be stored and reconstituted for optimal experimental use?

For optimal experimental use, recombinant Or33c should be handled according to these methodological guidelines:

  • Storage: Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles .

  • Reconstitution protocol:

    • Centrifuge vial briefly before opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration (50% is recommended)

    • Aliquot for long-term storage at -20°C/-80°C

  • Working storage: For short-term use, working aliquots can be stored at 4°C for up to one week .

The protein is supplied as a lyophilized powder in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

What expression systems are used for producing recombinant Or33c protein?

Recombinant Or33c is typically expressed in E. coli with an N-terminal His-tag for purification purposes . The methodological approach involves:

  • Cloning the full-length Or33c gene (1-384aa) into an appropriate expression vector

  • Transforming E. coli with the construct

  • Inducing protein expression

  • Lysing cells and purifying the His-tagged protein through affinity chromatography

  • Analyzing protein purity via SDS-PAGE (purity should exceed 90%)

The His-tag fusion allows for single-step purification and can be used for detection in downstream applications.

How conserved is Or33c across Drosophila species, and what does this indicate about its functional significance?

Analysis of Or33c across different Drosophila species reveals significant evolutionary conservation. Comparative genomics studies show that Or33c exhibits 82.2% amino acid sequence similarity between D. melanogaster and the agricultural pest D. suzukii . This high degree of conservation suggests functional importance in olfactory perception.

The methodological approach to studying this conservation involves:

  • Extracting ortholog sequences from genomic databases

  • Amplifying the genes from cDNA libraries

  • Cloning and sequencing the amplified products

  • Aligning amino acid sequences for comparison

The conservation extends beyond mere sequence similarity to functional aspects:

Odorant ReceptorAmino Acid Similarity between D. melanogaster and D. suzukii
Or33c82.2%
Or42a90.0%
Or46a83.5%
Or59c78.4%
Or71a81.4%
Or85d86.5%
Or85e85.0%

What electrophysiological methods are most effective for characterizing Or33c function?

For optimal electrophysiological characterization of Or33c function, researchers should consider these methodological approaches:

  • Single-sensillum recordings (SSR): This technique allows for measuring the neuronal response of Or33c-expressing neurons to various odorants.

  • Stimulus application protocol:

    • Test compounds at multiple concentrations (typically from 10⁻⁵ to 10⁻² dilutions)

    • Include proper controls and solvent-only trials

    • Apply stimuli in randomized order to prevent adaptation effects

  • Data analysis methods:

    • Analyze spike frequency in response to stimuli

    • Use appropriate curve-fitting methods for dose-response relationships

    • Apply either two-parameter or four-parameter logistic regression methods depending on the response pattern

    • For responses that don't reach saturation (as with some compounds at 10⁻² concentration), use four-parameter method without normalization

  • Heterologous expression systems:

    • The "empty neuron" system can be employed by using Or67dGAL4 line to express Or33c in the at1 neurons lacking their native receptor

    • This allows for functional characterization in a controlled neuronal environment

  • Cross-species validation:

    • Compare responses across different Drosophila species to assess functional conservation

    • This approach can reveal evolutionary adaptations in olfactory perception

How can 3D structural prediction tools like AlphaFold2 be used to study Or33c structure-function relationships?

AlphaFold2 and similar 3D structural prediction tools provide valuable insights into Or33c structure-function relationships. The methodological framework includes:

  • Structure prediction workflow:

    • Input the Or33c amino acid sequence into ColabFold or similar AlphaFold2 implementation

    • Select the highest-ranking model (rank1) for analysis

    • Focus on regions where predicted Local Distance Difference Test (pLDDT) scores exceed 70, as structures with lower scores are often unreliable

  • Structural analysis approach:

    • Focus on transmembrane regions, particularly S5-S6 transmembrane helices, as previous studies suggest these regions contain binding pockets for odorants

    • Calculate root mean square deviation (RMSD) scores between aligned structures to quantify structural differences

    • Perform 3D alignment with related odorant receptors to identify conserved structural features

  • In silico mutagenesis for functional prediction:

    • Perform virtual substitutions of amino acids in the sequence

    • Re-input modified sequences into the prediction algorithm

    • Compare RMSD scores of wild-type and mutated structures

    • Continue this process until identifying mutations that significantly alter the predicted structure

  • Structure-function correlation:

    • Correlate structural predictions with experimental functional data

    • Identify potential ligand binding sites based on structural features

    • Validate predictions through site-directed mutagenesis and functional assays

This computational approach provides hypotheses about structure-function relationships that can guide experimental design for receptor characterization.

What behavioral assays are most appropriate for studying Or33c-mediated olfactory responses?

To effectively study Or33c-mediated olfactory behaviors, researchers should employ these methodological approaches:

  • T-maze assays:

    • This binary choice assay measures innate attraction or aversion

    • Flies are given choices between control and test odors

    • Responses are typically concentration-dependent, with many pure chemicals becoming repellent at higher concentrations (e.g., 10⁻² concentration)

    • Behavioral responses should be tested across multiple concentrations to establish dose-response relationships

  • Immobility assay:

    • Conducted in a two-chamber setup with a mesh barrier

    • Upper chamber houses flies (typically 8-10 male flies aged 3-5 days)

    • Lower chamber contains odor solutions or solvent controls

    • This assay can reveal subtle behavioral responses not captured by choice assays

  • Genetic controls:

    • Compare wild-type flies with Orco mutants (lacking the co-receptor necessary for Or function)

    • Orco mutant flies typically show no attraction to compounds that attract wild-type flies, confirming Or-dependence of the behavior

    • Testing Or33c-specific mutants or RNAi knockdowns can isolate the contribution of this specific receptor

  • Cross-species comparative behavioral testing:

    • Test behavioral responses in different Drosophila species with conserved Or33c

    • This approach reveals whether behavioral outputs are conserved across species despite potential sequence differences

Through these assays, researchers can establish the behavioral significance of Or33c in olfactory perception and link molecular function to organismal behavior.

How does Or33c integrate into the broader olfactory circuit of Drosophila melanogaster?

Understanding Or33c's role in the olfactory circuit requires a multifaceted methodological approach:

  • Anatomical characterization:

    • Or33c is expressed in specific MP-OSNs (maxillary palp olfactory sensory neurons)

    • MP-OSNs project to distinct glomeruli in the antennal lobe

    • Each MP-OSN type, including those expressing Or33c, functions as the sole or primary detector for specific compounds

  • Functional circuit analysis:

    • MP-OSNs mediate both short- and long-range attraction behaviors

    • Or33c requires the co-receptor Orco for function, as demonstrated by anosmic phenotypes in Orco mutants

    • Higher concentrations of ligands (10⁻²) can trigger aversion independently of Or function, suggesting parallel processing pathways

  • Neural circuit tracing methods:

    • Use GAL4-UAS system to express markers in Or33c-expressing neurons

    • Employ trans-synaptic tracers to identify downstream neural targets

    • Combine with functional imaging to correlate neural activity with behavior

  • Integration with other olfactory subsystems:

    • Compare functions with antennal olfactory receptors

    • The antenna is involved in finding food, oviposition sites, and mates, while the maxillary palp serves complementary functions

    • Or33c likely contributes to specific aspects of these olfactory-guided behaviors

This integrated approach reveals how Or33c contributes to the complex olfactory processing that guides insect behavior.

What role does Or33c play in neuronal survival and axon targeting?

While specific studies on Or33c's role in neuronal survival and axon targeting are not directly presented in the search results, methodological approaches can be derived from studies of other olfactory receptors:

  • Cell survival assessment:

    • Different ORN classes show variable sensitivity to mutations affecting neuronal survival

    • For example, Or42a neuron numbers can be reduced by 83% while Or59c numbers may only be reduced by 46% in certain mutant backgrounds

    • Quantification of Or33c-expressing neurons in various genetic backgrounds can reveal factors affecting their survival

  • Axon targeting analysis:

    • Axon targeting defects and cell survival represent two distinct cellular processes

    • Expression of anti-apoptotic proteins like p35 can rescue cell number without rescuing targeting defects

    • Conversely, some genetic manipulations can rescue targeting without affecting cell number

  • Molecular mechanisms of targeting:

    • Actin dynamics play a crucial role in axon targeting

    • Conditions promoting actin destabilization or stabilization can rescue or aggravate targeting defects, respectively

    • The N-acetyltransferase complex B (NatB) influences neuron survival through protein acetylation

  • Experimental approach:

    • Use genetic mosaic analysis to study cell-autonomous effects

    • Employ immunohistochemistry to visualize axon projections

    • Compare targeting of Or33c neurons with other ORN classes to identify receptor-specific effects

Understanding these mechanisms for Or33c specifically would require targeted studies using these methodological frameworks.

What are the optimal PCR conditions for amplifying Or33c from Drosophila melanogaster?

Based on methodologies used for related odorant receptor genes, the optimal PCR conditions for amplifying Or33c include:

  • Sample preparation:

    • Collect approximately 100 flies' antennal segments and maxillary palps

    • Homogenize with ceramic beads for 15 minutes at 50 Hz in a TissueLyser

    • Extract total RNA using TRizol isolation protocol

    • Verify RNA quality by gel electrophoresis and spectrophotometric concentration measurement

    • Synthesize cDNA using SuperScript III First-Strand Synthesis Kit

  • PCR parameters:

    • Primer design: Based on the Or33c sequence with appropriate restriction sites

    • Annealing temperature: 57°C (optimal for most Drosophila odorant receptor amplification)

    • Extension time: Appropriate for the 1.2kb Or33c coding sequence (~1-2 minutes)

  • Primer sequences (based on related receptor amplification strategies):

    • Forward primer: 5′-ACC ATG VTC ATC ATC GAT AGT-3′ (including start codon)

    • Reverse primer: 5′-CTA TAT ACC TTT CAC CCG CAC-3′ (including stop codon)

  • Post-PCR processing:

    • Clone PCR products into pCR2.1 vector or similar

    • Perform sequencing to confirm identity and exclude PCR-introduced mutations

This methodology provides high-quality Or33c amplicons suitable for subsequent cloning and expression studies.

How can CRISPR-Cas9 be used to study Or33c function in vivo?

CRISPR-Cas9 genome editing offers powerful approaches for studying Or33c function in vivo:

  • Knockout strategy:

    • Design guide RNAs targeting exonic regions of Or33c

    • Introduce frameshift mutations or large deletions to completely abolish function

    • Verify editing by sequencing and functional assays

  • Precise editing approaches:

    • Create point mutations to study structure-function relationships

    • Target specific residues identified through computational structural analysis

    • Use homology-directed repair with a donor template containing desired mutations

  • Reporter knock-ins:

    • Insert fluorescent protein genes in-frame with Or33c

    • This allows visualization of expression patterns without disrupting function

    • Can be combined with conditional expression systems

  • Experimental validation:

    • Perform electrophysiological recordings to assess functional consequences

    • Use behavioral assays to determine effects on olfactory perception

    • Compare edited lines with controls for developmental or off-target effects

  • Cross-species applications:

    • Apply similar strategies to edit Or33c orthologs in other Drosophila species

    • This allows direct testing of functional conservation hypotheses

    • Particularly valuable for pest species like D. suzukii

These genome editing approaches provide precise tools for dissecting Or33c function at the molecular, cellular, and behavioral levels.

How should dose-response data for Or33c ligands be analyzed and interpreted?

Proper analysis of dose-response data for Or33c ligands requires rigorous methodological approaches:

  • Data fitting methodologies:

    • Two-parameter logistic regression method: Suitable for typical dose-response curves

    • Four-parameter method without normalization: Required when the two-parameter method fails to fit or when responses don't reach saturation at highest tested concentrations

    • When both methods fail due to lack of convergence at lowest concentrations (10⁻⁵), use the minimum value observed within that chemical-species group

  • Statistical analysis framework:

    • Calculate EC50 values (effective concentration eliciting 50% of maximum response)

    • Determine response thresholds (minimum concentration eliciting significant response)

    • Compare response magnitudes at saturating concentrations

    • Apply appropriate statistical tests to compare responses across different ligands

  • Data visualization recommendations:

    • Plot dose-response curves with log-transformed concentration on x-axis

    • Include error bars representing standard error or deviation

    • Present raw spike counts alongside normalized data when appropriate

    • Use consistent scaling when comparing multiple ligands

  • Interpretation guidelines:

    • Consider the biological context of concentration ranges

    • Evaluate selectivity by comparing responses to structurally related compounds

    • Assess specificity by comparing responses in neurons expressing different receptors

    • Correlate electrophysiological responses with behavioral outputs

This systematic approach ensures robust and reproducible analysis of Or33c ligand interactions.

What statistical methods are appropriate for comparing Or33c sequence conservation across species?

To rigorously analyze Or33c sequence conservation across Drosophila species, researchers should employ these statistical and bioinformatic methods:

  • Sequence alignment and similarity metrics:

    • Multiple sequence alignment using tools like MUSCLE or CLUSTAL

    • Calculate percent identity and similarity between sequences

    • Identify conserved domains and variable regions

    • Generate conservation scores for each amino acid position

  • Evolutionary analysis approaches:

    • Calculate dN/dS ratios to identify selective pressures

    • Positive selection (dN/dS > 1) suggests adaptive evolution

    • Negative/purifying selection (dN/dS < 1) indicates functional constraints

    • Use methods like PAML to identify specific sites under selection

  • Structural conservation assessment:

    • Map conservation data onto predicted 3D structures

    • Focus on transmembrane domains and potential binding pockets

    • Calculate structural conservation indices for functional regions

    • Compare conservation patterns of Or33c with other odorant receptors

  • Functional correlation analysis:

    • Correlate sequence conservation with functional data when available

    • Test whether conserved regions correspond to ligand binding sites

    • Analyze whether species-specific variations correlate with ecological adaptations

    • Use statistical tests to determine significance of correlation patterns

These methods provide a comprehensive framework for understanding the evolutionary patterns of Or33c and their functional implications.

What are common pitfalls in expressing recombinant Or33c and how can they be addressed?

Researchers working with recombinant Or33c may encounter several challenges. Here are methodological solutions to common issues:

  • Low expression levels:

    • Optimize codon usage for E. coli expression

    • Try different E. coli strains (BL21, Rosetta for rare codons)

    • Optimize induction conditions (temperature, IPTG concentration, induction time)

    • Consider fusion partners that enhance solubility (MBP, GST, SUMO)

  • Protein insolubility:

    • Express at lower temperatures (16-20°C)

    • Reduce inducer concentration

    • Add solubility enhancers to lysis buffer (glycerol, mild detergents)

    • Consider membrane protein extraction protocols with appropriate detergents

  • Protein degradation:

    • Add protease inhibitors during purification

    • Reduce purification time and temperature

    • Optimize buffer conditions (pH, salt concentration)

    • Consider adding stabilizing agents during storage (glycerol, trehalose)

  • Purification challenges:

    • Optimize imidazole concentrations in wash and elution buffers

    • Try different metal ions for His-tag purification (Ni²⁺, Co²⁺)

    • Consider on-column refolding for insoluble proteins

    • Validate purification by SDS-PAGE and Western blotting

  • Activity loss during storage:

    • Aliquot protein immediately after purification

    • Avoid repeated freeze-thaw cycles

    • Test different buffer compositions for storage

    • Consider lyophilization with appropriate cryoprotectants

These systematic approaches address the major challenges in working with recombinant Or33c protein.

How can researchers troubleshoot inconsistent electrophysiological recordings from Or33c-expressing neurons?

Inconsistent electrophysiological recordings from Or33c-expressing neurons can arise from multiple sources. Here are methodological solutions:

  • Electrode and recording setup issues:

    • Standardize electrode resistance (typically 10-50 MΩ for single-sensillum recordings)

    • Ensure proper grounding and shielding to minimize electrical noise

    • Maintain consistent temperature during recordings (temperature affects neuronal response)

    • Calibrate amplifier and digitization settings regularly

  • Stimulus delivery problems:

    • Standardize odor cartridge preparation

    • Verify odor concentrations using photoionization detector

    • Control airflow rates precisely

    • Implement regular blank stimulations to check for contamination

    • Allow sufficient recovery time between stimulations (typically 30-60 seconds)

  • Biological variability sources:

    • Control for fly age (typically use 3-5 day old flies)

    • Standardize rearing conditions (temperature, humidity, diet)

    • Control for circadian effects (perform recordings at consistent times)

    • Consider sex differences in receptor expression and function

    • Verify genotypes of experimental flies

  • Data analysis considerations:

    • Implement consistent spike detection algorithms

    • Apply appropriate filtering to raw recordings

    • Use appropriate statistical methods for comparing responses

    • Consider normalization methods when comparing across preparations

    • Account for spontaneous activity in analysis

  • Validation approaches:

    • Include positive control stimuli with known responses

    • Verify neuronal identity through genetic labeling

    • Compare recordings with published response profiles

    • Correlate electrophysiological data with behavioral responses

This systematic troubleshooting approach helps ensure reliable and reproducible electrophysiological data from Or33c-expressing neurons.

What emerging technologies could advance our understanding of Or33c function?

Several cutting-edge technologies offer promising approaches for deeper insights into Or33c function:

  • Cryo-EM structural analysis:

    • Recent advances allow structural determination of membrane proteins

    • Could provide actual structures rather than predictions

    • May reveal ligand binding sites and conformational changes

    • Would complement AlphaFold2 predictions with experimental data

  • Single-cell transcriptomics:

    • Characterize gene expression profiles in Or33c-expressing neurons

    • Identify co-expressed genes that may influence receptor function

    • Compare expression patterns across developmental stages

    • Reveal species-specific differences in expression regulation

  • Optogenetic and chemogenetic approaches:

    • Selectively activate or silence Or33c-expressing neurons

    • Dissect the contribution of specific neural circuits to behavior

    • Combine with functional imaging to map information flow

    • Test sufficiency and necessity of Or33c activation for behaviors

  • Advanced imaging techniques:

    • Voltage imaging for monitoring neuronal activity with high temporal resolution

    • Super-resolution microscopy for detailed morphological analysis

    • Calcium imaging combined with natural odor stimulation

    • Whole-brain functional imaging during olfactory behaviors

  • Computational modeling and simulation:

    • Molecular dynamics simulations of ligand-receptor interactions

    • Circuit-level modeling of olfactory processing

    • AI-assisted prediction of novel ligands

    • Integration of structural, functional, and behavioral data

These emerging technologies promise to transform our understanding of Or33c function from molecular to behavioral levels.

What are the potential applications of Or33c research in pest management and disease control?

Research on Or33c has significant translational potential, particularly for agricultural pest management:

  • Pest control applications:

    • The high conservation of Or33c (82.2%) between D. melanogaster and the agricultural pest D. suzukii suggests potential targets for pest management

    • Compounds that activate Or33c could be used as attractants in monitoring traps

    • Highly selective attractants could be developed based on species-specific differences

    • Integration of attractants into integrated pest management (IPM) programs

  • Methodological approach to developing attractants:

    • Screen for compounds that selectively activate Or33c

    • Test efficacy in laboratory behavioral assays

    • Evaluate field performance of candidate attractants

    • Optimize formulation for sustained release and environmental stability

  • Repellent development strategy:

    • Identify compounds that antagonize Or33c function

    • Test concentration-dependent effects (many compounds become repellent at higher concentrations)

    • Evaluate behavioral responses in field settings

    • Develop application methods for crop protection

  • Target validation framework:

    • Confirm Or33c as the molecular target using genetic approaches

    • Test whether behavioral responses require Or function by testing in Orco mutants

    • Evaluate cross-species conservation of responses

    • Assess potential for resistance development

This research direction has significant economic potential by contributing to sustainable pest management strategies for agricultural pests like D. suzukii.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.