Recombinant Drosophila melanogaster Odorant receptor 43b (Or43b)

Shipped with Ice Packs
In Stock

Description

Introduction to Drosophila Odorant Receptors

Odorant receptors in Drosophila melanogaster constitute a diverse family of proteins that function as the primary molecular detectors in the insect's olfactory system. These specialized receptors are expressed in olfactory sensory neurons located within sensilla, specialized structures found primarily on the antennae of adult flies. Unlike mammalian odorant receptors, which function as G protein-coupled receptors, Drosophila odorant receptors operate as ligand-gated ion channels, forming heteromeric complexes with the broadly expressed co-receptor Or83b (also known as Orco).

The Drosophila genome encodes approximately 60 conventional odorant receptor proteins, each typically expressed in specific subsets of olfactory neurons. This arrangement creates a sophisticated combinatorial coding system that enables the fly to detect and discriminate between a vast array of environmental odorants despite having a relatively limited number of receptor types. The specificity of odor detection is largely determined by which OR proteins are expressed in particular neurons, with each receptor exhibiting unique odorant response profiles.

Within this diverse receptor family, Or43b represents a specifically characterized odorant receptor with distinct expression patterns and functional properties. Studying individual receptors like Or43b is crucial for understanding how the olfactory system processes chemical information and translates it into appropriate behavioral responses. The availability of recombinant Or43b protein has significantly advanced research in this field by providing purified material for structural, biochemical, and functional analyses.

Functional Role of Or43b in Olfaction

The specific function of Or43b in the Drosophila olfactory system has been elucidated through targeted mutation studies that have provided definitive evidence for its role in odor detection. Research has established that Or43b is essential for conferring odor responsiveness to ab8A neurons, a specific functional class of olfactory neurons in the Drosophila antenna . These neurons represent one distinct population among the diverse array of olfactory sensory neurons that collectively enable the fly's sense of smell.

An important aspect of Or43b function relates to its interaction with the broadly expressed co-receptor Or83b. Experimental evidence indicates that while Or83b is expressed in a large fraction of olfactory neurons, including those that express Or43b, it cannot confer odor responsiveness in the absence of Or43b . This finding demonstrates the complementary roles of specific odorant receptors like Or43b and the co-receptor Or83b, with both being necessary for functional olfactory transduction.

Genetic Studies and Mutant Analysis of Or43b

Sophisticated genetic techniques have been employed to create specific mutations in the Or43b gene, enabling detailed analysis of its function in vivo. Researchers have utilized gene targeting through homologous recombination to produce null mutants specifically defective for the Or43b odorant receptor . This approach allowed for the precise modification of the endogenous gene without disrupting other genomic regions, providing a clean experimental system for functional studies.

The methodology for generating Or43b mutants involved constructing a targeting vector containing the Or43b gene with introduced stop codons and recombination sites. The targeting construct was integrated into the fly genome through a series of genetic crosses involving heat shock-induced expression of site-specific recombinases and endonucleases . This elaborate genetic manipulation resulted in the successful creation of Or43b null alleles that completely abolished functional expression of the receptor.

Table 1: Comparison of Phenotypes Between Wild-Type and Or43b Mutant Flies

Phenotypic FeatureWild-TypeOr43b Mutant
Presence of ab8A neuronsPresentPresent
Spontaneous neuronal activityPresentPresent
Odor-evoked neuronal responsesPresentAbsent
Olfactory behaviorNormalNormal
Or83b expressionPresentPresent

Perhaps the most surprising finding was that olfactory behavior elicited by odorants that activate ab8A neurons remained indistinguishable between Or43b mutants and control flies . This observation reveals a remarkable degree of functional redundancy in the Drosophila olfactory system, suggesting that multiple pathways exist for detecting particular odorants, ensuring that critical olfactory behaviors are maintained even when specific components of the system are compromised.

Evolutionary Conservation of Or43b

Molecular evolutionary analysis provides valuable insights into the functional significance of Or43b across Drosophila species. Studies examining the selective pressures acting on odorant receptor genes have included Or43b among the receptors analyzed for patterns of sequence conservation and divergence.

Table 2: Molecular Evolution Data for Selected Drosophila Odorant Receptor Genes

GenedN/dSP ValueCorrected P Value
Or43b0.12321.000001.0000
Or43a0.19420.001810.0178*
Or83b0.03491.000001.0000
Or9a0.11220.001290.0178*
Or10a0.22430.002940.0248*

*Statistically significant at p < 0.05

The evolutionary data indicates that Or43b has a dN/dS ratio of 0.1232 , which represents the ratio of non-synonymous (amino acid-changing) to synonymous (silent) nucleotide substitutions. A dN/dS ratio less than 1 indicates purifying selection, suggesting that changes in the protein sequence are generally deleterious and selected against during evolution. The relatively low dN/dS ratio for Or43b suggests that this receptor has an important conserved function across Drosophila species, with natural selection acting to maintain its specific structural and functional properties.

It is noteworthy that the co-receptor Or83b shows an even lower dN/dS ratio of 0.0349 , reflecting its critical and highly conserved role as an essential component of the olfactory transduction machinery across all insects. The stronger purifying selection on Or83b compared to Or43b is consistent with its function as a universal co-receptor required for the activity of multiple odorant receptors.

The evolutionary conservation of Or43b implies that its specific function in detecting particular odorants has been maintained throughout Drosophila evolution. This conservation suggests that the odorants detected by Or43b are ecologically relevant across various Drosophila species, despite their diverse habitats and life histories, pointing to its fundamental importance in the insect's sensory ecology.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
Or43b; AN7; DOR25A.1; OR44A.1; CG17853; Odorant receptor 43b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-403
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or43b
Target Protein Sequence
MFGHFKLVYPAPISEPIQSRDSNAYMMETLRNSGLNLKNDFGIGRKIWRVFSFTYNMVIL PVSFPINYVIHLAEFPPELLLQSLQLCLNTWCFALKFFTLIVYTHRLELANKHFDELDKY CVKPAEKRKVRDMVATITRLYLTFVVVYVLYATSTLLDGLLHHRVPYNTYYPFINWRVDR TQMYIQSFLEYFTVGYAIYVATATDSYPVIYVAALRTHILLLKDRIIYLGDPSNEGSSDP SYMFKSLVDCIKAHRTMLNFCDAIQPIISGTIFAQFIICGSILGIIMINMVLFADQSTRF GIVIYVMAVLLQTFPLCFYCNAIVDDCKELAHALFHSAWWVQDKRYQRTVIQFLQKLQQP MTFTAMNIFNINLATNINVAKFAFTVYAIASGMNLDQKLSIKE
Uniprot No.

Target Background

Function
Odorant receptor mediating acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a vast collection of odor stimuli that vary widely in identity, intensity, and duration. It may form a complex with Orco to create odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability.
Gene References Into Functions
  1. A null mutant of the putative odorant receptor Or43b was produced and found defective for odor-evoked activity in ab8A neurons, a single functional class of olfactory neurons in Drosophila. PMID: 14586020
Database Links

KEGG: dme:Dmel_CG17853

STRING: 7227.FBpp0087962

UniGene: Dm.23905

Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or2a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in 16 olfactory receptor neurons in a broad area across the antenna, including both anterior and posterior faces and in the maxillary palp. This expression pattern matches the distribution of the small sensilla basiconica. Expression in the ante

Q&A

What is Or43b and where is it expressed in Drosophila melanogaster?

Or43b is a member of the odorant receptor family in Drosophila melanogaster, expressed exclusively in a subset of olfactory sensory neurons (OSNs) located in the third antennal segment. Specifically, Or43b localizes to a small subset of basiconic sensilla, predominantly on the posterior surface of the antenna. Immunohistochemistry studies have confirmed that Or43b is not present in other classes of sensilla .

At the subcellular level, the Or43b receptor protein is concentrated within the dendrites of olfactory neurons but is also present in their axons, consistent with a direct role in odorant transduction . This localization pattern supports the hypothesis that Or43b is involved in the detection and processing of specific odorant molecules.

The standard methodology for determining Or43b expression includes:

  • Immunohistochemistry using anti-Or43b antiserum on frozen antennal sections

  • In situ hybridization with antisense riboprobes

  • Fluorescent protein tagging (e.g., GFP:OR43b) for visualization in live tissue

What is known about the functional role of Or43b in olfactory neurons?

Or43b is required for odor responsiveness in ab8A neurons, a specific functional class of olfactory neurons in Drosophila. Gene targeting experiments creating Or43b null mutants have demonstrated that ab8A neurons lacking Or43b are still present and display spontaneous activity but are completely insensitive to odor stimulation .

Interestingly, even though Or43b is necessary for the electrophysiological response of ab8A neurons to odorants, behavioral studies have shown that olfactory behavior elicited by odorants that activate ab8A neurons is indistinguishable between Or43b mutants and controls. This suggests a surprising degree of functional redundancy among the limited odor receptor repertoire in Drosophila .

Or43b is not independently sufficient for odor detection and requires co-expression with Or83b, a broadly expressed co-receptor that forms heterodimers with conventional ORs to create functional receptor complexes .

When during development is Or43b protein expressed?

Studies have shown that Or43b protein is only detectable relatively late in Drosophila development . This timing is significant because it suggests that Or43b may not be required for the initial synaptic target choice of the olfactory neurons in which it is expressed. Rather, its expression coincides with the later stages of olfactory system development when the neurons are becoming functionally mature and capable of responding to odorants .

The delayed expression of Or43b contrasts with vertebrate olfactory systems where odorant receptors often play roles in axon guidance and glomerular targeting. This represents one of several differences between insect and vertebrate olfactory system development.

What techniques are used to generate recombinant Or43b and Or43b mutants?

Several approaches have been employed to study recombinant Or43b:

Gene targeting via homologous recombination:
The primary method used to generate Or43b null mutants involves gene targeting through homologous recombination. The detailed methodology includes:

  • Construction of a targeting vector containing:

    • The Or43b gene with introduced stop codons

    • The white gene as a selectable marker

    • FLP recombination sites and I-SceI cleavage sites

  • Transformation of Drosophila with the targeting construct using standard methods.

  • Triggering homologous recombination through heat shock (37°C for 1 hour) to induce expression of FLP recombinase and I-SceI endonuclease.

  • Screening for successful recombinants based on eye color (red eyes indicating translocation of the white+ marker).

  • Verification through PCR analysis and sequencing of the targeted locus.

This approach typically results in a duplication of the Or43b gene with each copy carrying a single nonsense mutation, effectively creating a null allele .

Expression of tagged receptors:
For localization and functional studies, Or43b can be tagged with fluorescent proteins like GFP. The methodology involves:

  • Cloning Or43b into expression vectors with N- or C-terminal fluorescent protein tags

  • Creating transgenic flies using standard transformation techniques

  • Expressing the tagged receptor using the GAL4/UAS system with appropriate drivers

How does Or43b interact with the co-receptor Or83b, and what is the significance of this interaction?

The interaction between Or43b and Or83b is essential for proper olfactory function:

  • Or43b and Or83b form heterodimers early in the endomembrane system in OSNs .

  • Or83b is required for trafficking Or43b to sensory cilia where odor signal transduction occurs. In Or83b mutants, GFP-tagged Or43a (as a model for ORs like Or43b) is delocalized and destabilized, with only weak signals detected in OSN cell bodies .

  • The OR/OR83b complex is necessary and sufficient for functional reconstitution of odor-evoked signaling in sensory neurons .

The exact nature of this interaction has been studied using techniques such as:

  • Co-expression of fluorescently tagged receptors

  • Calcium imaging to assess functional responses

  • Bimolecular fluorescence complementation

  • Ectopic expression experiments

Experimental data indicates that when YFP(1):OR43a and YFP(2):OR83b are co-expressed in Or83b mutant animals, they can restore functional odor responses to characterized OR43a ligands such as cyclohexanol and benzaldehyde .

What is the membrane topology of Or43b and how does it differ from vertebrate olfactory receptors?

One of the most unexpected findings regarding Drosophila ORs is their atypical membrane topology:

Drosophila ORs, including Or43b, adopt a novel membrane topology with their N-termini and the most conserved loops positioned in the cytoplasm . This topology is inverted compared to vertebrate and nematode chemosensory receptors, which have their N-termini in the extracellular space.

The cytoplasmic loops of Drosophila ORs mediate direct association with Or83b, forming the functional heteromeric complex . This atypical heteromeric and topological design appears to be an insect-specific solution for odor recognition, making the OR/Or83b complex distinct from vertebrate odorant receptors, which are G-protein coupled receptors (GPCRs).

This unusual topology has significant implications for:

  • Odorant binding mechanisms

  • Signal transduction pathways

  • Potential for targeted insect repellents that specifically disrupt insect olfaction

How is allelic regulation of Or43b different from vertebrate odorant receptor expression?

The regulation of Or43b expression shows important differences from vertebrate odorant receptor expression:

In vertebrates, individual olfactory neurons typically express a single odorant receptor gene from one allele, a phenomenon known as monogenic and monoallelic expression .

In contrast, studies of Drosophila Or43b suggest a different regulatory mechanism. Flies carrying deletions removing one copy of Or43b have the same number of Or43b-positive cells in the antenna as flies with two copies, suggesting that simple allelic exclusion of odor receptors may not occur in Drosophila .

This finding indicates that Drosophila and vertebrates likely employ different developmental processes to establish the neuronal architecture of the olfactory system . The regulatory mechanisms governing OR expression in Drosophila appear to be distinct and may involve different transcriptional control elements.

What are the best methods for studying Or43b function in vivo?

Several complementary approaches provide robust assessment of Or43b function:

Electrophysiological recordings:
Single sensillum recordings (SSR) from ab8A neurons allow direct measurement of neuronal responses to odor stimulation. Comparing wild-type and Or43b mutant responses provides clear evidence of receptor function .

Calcium imaging:
Expression of calcium indicators like G-CaMP in Or43b neurons or their projection targets in the antennal lobe enables visualization of odor-evoked neural activity. The search results demonstrate this approach showing responses to specific OR43a ligands that can be adapted for Or43b studies .

Behavioral assays:
Population cage assays using odorant traps to assess attraction or repulsion to specific odorants. These typically involve:

  • Starving flies for 12 hours

  • Introducing 100-300 odorant traps with defined dilutions of test compounds

  • Counting flies in each trap after 12-24 hours

  • Comparing responses between Or43b mutants and control flies

For robust results, researchers typically consider differences of twofold or greater as significant in behavioral assays .

How can researchers identify specific odorants that activate Or43b?

A systematic approach to identifying Or43b ligands includes:

  • Screening diverse odorant panels:

    • Testing compounds from different chemical classes (alcohols, aldehydes, esters, etc.)

    • Using a range of concentrations (typically 10^-7 to 10^-2 dilutions)

    • Maintaining consistent delivery methods across experiments

  • Electrophysiological validation:

    • Single sensillum recordings from ab8A neurons

    • Comparison of wild-type responses to Or43b mutant responses to confirm specificity

    • Dose-response analysis for confirmed ligands

  • Functional imaging confirmation:

    • Calcium imaging of Or43b neurons or their glomerular targets

    • Assessment of response dynamics (amplitude, onset, offset)

    • Spatial mapping of activated glomeruli

  • Heterologous expression systems:

    • Co-expression of Or43b with Or83b in cell lines

    • Fluorescent calcium indicators or voltage sensors to detect responses

    • Validation of identified ligands from in vivo studies

The search results mention a complete list of screened odorants available as supplemental data from one study, which would provide a starting point for systematic investigation .

What approaches can be used to study the trafficking of recombinant Or43b?

Understanding Or43b trafficking requires multiple complementary techniques:

  • Fluorescent protein tagging:

    • Expression of GFP:Or43b fusion proteins to visualize localization in vivo

    • Live imaging to track receptor movement within cells

    • Comparison between wild-type and Or83b mutant backgrounds to assess dependency

  • Immunohistochemistry:

    • Antibody staining of fixed tissue sections

    • Co-labeling with markers for specific cellular compartments (ER, Golgi, plasma membrane)

    • Quantification of receptor distribution in different cellular regions

  • Genetic manipulation approaches:

    • Targeted mutations in trafficking motifs within Or43b

    • RNAi knockdown of candidate trafficking factors

    • Temperature-sensitive conditional alleles to control timing of expression

  • Biochemical approaches:

    • Subcellular fractionation to isolate different membrane compartments

    • Western blotting to assess receptor processing and maturation

    • Biotinylation assays to quantify surface expression

The search results clearly demonstrate that Or83b is essential for proper trafficking of ORs like Or43b to the sensory cilia , making the Or83b-dependent trafficking pathway a critical focus for such studies.

How should researchers interpret contradictions between physiological and behavioral Or43b data?

The search results reveal an intriguing contradiction: Or43b mutants show complete loss of odor-evoked activity in ab8A neurons but display normal behavioral responses to odorants that activate these neurons . Several frameworks can help interpret such discrepancies:

  • Functional redundancy analysis:

    • Map overlapping receptive fields of multiple ORs

    • Identify other receptors responding to the same odorants as Or43b

    • Create and test double or triple receptor mutants to reduce redundancy

  • Sensitivity analysis:

    • Test behavioral responses across wider concentration ranges

    • Determine threshold differences between electrophysiological and behavioral assays

    • Consider adaptation effects that might occur in natural settings but not in acute recordings

  • Circuit-level compensation:

    • Analyze activity patterns across the entire antennal lobe

    • Map how information from multiple channels is integrated

    • Consider lateral inhibition and other network effects

This type of contradiction highlights the complexity of olfactory coding and the importance of integrating data across multiple levels of analysis from molecules to behavior.

What statistical approaches are appropriate for analyzing Or43b expression data?

Based on the methodologies described in the search results, appropriate statistical approaches include:

  • For immunohistochemistry quantification:

    • Multiple samples (n ≥ 5 animals per genotype)

    • Blind scoring to prevent experimenter bias

    • Appropriate normalization to control for staining variability

    • Non-parametric tests if distributions are not normal

  • For functional response data:

    • Repeated measures designs when testing multiple odorants on the same preparation

    • Area-under-curve analysis for temporal response profiles

    • Multiple comparison corrections when screening many compounds

  • For behavioral assays:

    • The search results mention requiring "consistent differences of twofold or greater" to be considered significant for population cage assays

    • ANOVA with appropriate post-hoc tests for comparing multiple genotypes or conditions

    • Consideration of time-of-day effects on olfactory behavior

What are the main challenges in heterologous expression of functional Or43b?

Heterologous expression of functional Or43b presents several challenges:

  • Requirement for Or83b co-expression:

    • Or43b requires Or83b to form functional receptor complexes

    • Expression vectors must contain both Or43b and Or83b genes

    • Stoichiometry between the two proteins may be critical

  • Atypical membrane topology:

    • The inverted topology of Drosophila ORs (N-terminus intracellular) differs from most GPCRs

    • Expression systems must accommodate this unusual configuration

    • Membrane composition may affect proper folding and function

  • Verification of functional expression:

    • Confirmation of proper trafficking to the cell surface

    • Validation of odorant responses using known ligands

    • Controls to distinguish receptor-mediated from non-specific responses

Potential solutions include:

  • Use of insect cell lines that may better support the unusual topology

  • Codon optimization for the expression system

  • Addition of trafficking signals to enhance surface expression

  • Development of stable cell lines with consistent expression levels

How can researchers overcome challenges in analyzing Or43b mutations?

Analysis of Or43b mutations requires careful experimental design:

  • Generation of precise mutations:

    • Gene targeting via homologous recombination as demonstrated in the search results

    • CRISPR/Cas9-based genome editing for more efficient targeting

    • Control for genetic background effects by comparing to precisely matched controls

  • Comprehensive phenotypic analysis:

    • Molecular verification (sequencing, RT-PCR, Western blotting)

    • Localization studies using antibodies or tagged receptors

    • Functional assessment through electrophysiology and calcium imaging

    • Behavioral testing using multiple paradigms

  • Structure-function analysis:

    • Targeted mutations in specific domains (N-terminus, transmembrane regions, loops)

    • Chimeric receptors combining regions from different ORs

    • Correlation of mutation effects with the unusual topology of Drosophila ORs

The search results mention a specific example of a naturally occurring polymorphism in Or43b on the SM5 balancer chromosome, including an arginine(128) to proline substitution in the first extracellular loop that correlates with reduced expression levels . This provides a model for how specific amino acid changes can affect receptor function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.