Recombinant Drosophila melanogaster Odorant receptor 46a, isoform B (Or46a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
Or46a; AN8; AN9; dor19; DOR46F; DOR46F.1; Or46b; OR46F; Or46F.1; Or46F.2; CG33478; Odorant receptor 46a, isoform B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or46a
Target Protein Sequence
MVTEDFYKYQVWYFQILGVWQLPTWAADHQRRFQSMRFGFILVILFIMLLLFSFEMLNNI SQVREILKVFFMFATEISCMAKLLHLKLKSRKLAGLVDAMLSPEFGVKSEQEMQMLELDR VAVVRMRNSYGIMSLGAASLILIVPCFDNFGELPLAMLEVCSIEGWICYWSQYLFHSICL LPTCVLNITYDSVAYSLLCFLKVQLQMLVLRLEKLGPVIEPQDNEKIAMELRECAAYYNR IVRFKDLVELFIKGPGSVQLMCSVLVLVSNLYDMSTMSIANGDAIFMLKTCIYQLVMLWQ IFIICYASNEVTVQSSRLCHSIYSSQWTGWNRANRRIVLLMMQRFNSPMLLSTFNPTFAF SLEAFGSIVNCSYSYFALLKRVNS
Uniprot No.

Target Background

Function
Odorant receptor 46a, isoform B (Or46a) is a receptor in Drosophila melanogaster that mediates acceptance or avoidance behavior depending on the specific odorant it encounters. The diverse repertoire of odorant receptors allows for the encoding of a wide range of odor stimuli, varying in identity, intensity, and duration. Or46a may form a complex with Orco to create odorant-sensing units, facilitating sensitive and prolonged odorant signaling and calcium permeability.
Database Links

KEGG: dme:Dmel_CG33478

STRING: 7227.FBpp0089408

UniGene: Dm.26891

Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or2a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Isoform B is expressed in the antenna.

Q&A

What is Odorant receptor 46a in Drosophila melanogaster and what is its significance in olfactory research?

Odorant receptor 46a (Or46a) is one of the chemosensory receptors in Drosophila melanogaster's olfactory system. It belongs to the odorant receptor (OR) family, one of the two main olfactory receptor gene families in Drosophila (the other being ionotropic receptors or IRs). Or46a plays a crucial role in the detection and discrimination of specific odorants. The significance of studying Or46a lies in understanding the fundamental mechanisms of olfactory coding, sensory perception, and the neural circuits that translate receptor responses into behavior. Research on Or46a contributes to our understanding of how animals detect, discriminate, and respond to odors at the molecular and neural levels .

How does Or46a function within the Drosophila olfactory system?

Or46a functions as part of a heteromeric complex with the co-receptor Orco in the dendrites of olfactory receptor neurons (ORNs). This complex forms a ligand-gated ion channel that opens in response to specific odorant binding. The OR-Orco complex allows cations to flow into the neuron, generating an electrical signal that is then transmitted to the antennal lobe of the brain.

What are the recommended protocols for recombinant expression of Or46a?

For recombinant expression of Or46a, researchers typically use bacterial expression systems such as E. coli. Based on methodologies used for similar Drosophila proteins, the following protocol is recommended:

  • Clone the Or46a cDNA into an expression vector such as pET15b, which includes a His-tag for purification purposes.

  • Transform the expression vector into a bacterial strain optimized for protein expression, such as BL21 E. coli.

  • Induce protein expression using IPTG at appropriate concentrations and durations based on optimization experiments.

  • Lyse the cells and perform initial purification using Ni-NTA affinity chromatography to bind the His-tagged protein.

  • Further purify the protein using ion exchange chromatography (e.g., HiTrap SP HP) and size exclusion chromatography (e.g., Superdex 75) to achieve high purity.

  • Store the purified protein in an appropriate buffer with 50% glycerol at -20°C or -80°C for extended storage .

For functional studies, expression in more complex systems such as Xenopus oocytes or human cell lines might be necessary to ensure proper folding and function of the receptor.

What methodologies are available for studying Or46a binding interactions with odorants?

Several methodologies are available for studying Or46a-odorant interactions:

  • Electrophysiological Recordings: Single sensillum recordings (SSR) can measure the electrical activity of neurons expressing Or46a in response to odorant stimulation. This method provides direct functional data on receptor activation.

  • Calcium Imaging: Using calcium-sensitive fluorescent dyes or genetically encoded calcium indicators (GECIs) to visualize changes in intracellular calcium levels when Or46a is activated by odorants.

  • Heterologous Expression Systems: Expressing Or46a along with Orco in cell lines or Xenopus oocytes and measuring responses to odorants using electrophysiology or calcium imaging.

  • Binding Assays: Using purified recombinant Or46a in direct binding assays with labeled odorants to determine binding affinities.

  • Systematic Odorant Screening: Challenging Or46a-expressing neurons with large panels of odorants to identify specific ligands, as was done in comprehensive studies that screened >10,000 receptor-odorant combinations for Drosophila olfactory receptors .

How can researchers verify the proper expression and localization of recombinant Or46a in experimental systems?

Researchers can verify proper expression and localization of recombinant Or46a using several complementary techniques:

  • Western Blotting: To confirm the expression of Or46a protein at the expected molecular weight.

  • Immunohistochemistry/Immunofluorescence: Using antibodies specific to Or46a or to epitope tags (if the recombinant protein is tagged) to visualize the localization of the protein in cells or tissues.

  • Co-localization Studies: Double-labeling with Orco and Or46a to confirm proper co-expression and co-localization, as functional odorant receptors require Orco for proper trafficking and function.

  • Functional Testing: Verifying that the expressed receptor responds to known ligands using electrophysiology or calcium imaging.

  • Genetic Knock-in Strategies: Using approaches similar to those employed for co-receptor studies, where knock-in expression patterns can be verified against endogenous expression patterns .

  • GFP Fusion Proteins: Creating fusion proteins with fluorescent tags like GFP to directly visualize expression and localization in live cells or tissues .

How does Or46a receptor sensitivity and temporal dynamics compare to other Drosophila odorant receptors?

Research has revealed dramatic diversity in the sensitivity and temporal dynamics among Drosophila odorant receptors, including Or46a. Systematic analysis of receptor responses to their cognate odorants has shown that:

  • Sensitivity Variation: Different odorant receptors show vastly different sensitivity thresholds to their cognate odorants. Some receptors require high concentrations of odorants for activation, while others respond to trace amounts.

  • Temporal Dynamics: Response patterns vary considerably, with some receptors (possibly including Or46a) capable of producing supersustained responses to continued odorant presence, while others show rapid adaptation.

  • Specificity Profiles: Under controlled test conditions, many odorants strongly excite a single receptor with minimal cross-activation of other receptors, suggesting that at low environmental concentrations, specific odorants might be signaled primarily by a single ORN type.

What is known about the relationship between Or46a activation and behavioral responses in Drosophila?

The relationship between Or46a activation and behavioral responses is complex and depends on multiple factors:

  • Variability in Behavioral Impact: Research has shown that odorants elicit behavioral responses that vary across a broad range. Some odorants that strongly activate receptors like Or46a may produce weak behavioral responses, while others that elicit weak physiological responses may trigger strong behaviors.

  • Neural Circuit Processing: The discrepancy between receptor activation strength and behavioral response magnitude suggests significant processing and modulation within the neural circuits downstream of the olfactory receptors.

  • Context Dependency: The behavioral significance of Or46a activation likely depends on the context, including the animal's physiological state (hungry vs. satiated), developmental stage, and the presence of other sensory cues.

  • Integration with Other Sensory Inputs: The ultimate behavioral output results from integration of multiple sensory inputs, not just the activation of a single receptor like Or46a.

This complex relationship provides a foundation for understanding how receptor-level responses are translated into behavioral outputs through intervening neural circuitry .

What techniques are used to study the genetic regulation of Or46a expression?

Several sophisticated techniques are employed to study the genetic regulation of Or46a expression:

  • Genomic Analysis: Utilizing genome databases and bioinformatics to identify potential regulatory regions upstream of the Or46a gene.

  • Reporter Gene Assays: Creating transgenic flies with reporter constructs (such as GFP) under the control of Or46a regulatory regions to visualize expression patterns.

  • CRISPR/Cas9 Genome Editing: Modifying regulatory elements to assess their impact on Or46a expression.

  • Chromatin Immunoprecipitation (ChIP): Identifying transcription factors that bind to the Or46a promoter region.

  • Gene Expression Profiling: Using techniques such as RNA-seq to analyze Or46a expression levels under different conditions or in different genetic backgrounds.

  • Recombinant Inbred Lines (RILs): Studying Or46a expression across different genetic backgrounds using Drosophila RILs that were created by mapping roo transposons in recombinants of divergent parental lines .

  • Single-Cell Transcriptomics: Analyzing gene expression at the single-cell level to understand the developmental and spatial regulation of Or46a expression.

How can researchers functionally characterize Or46a responses to various odorants?

Functional characterization of Or46a responses requires a multi-faceted approach:

  • Systematic Odorant Screening: Testing large panels of odorants (>500) at various concentrations to identify those that activate Or46a, similar to comprehensive screens that have identified cognate odorants for 19 different Drosophila odorant receptors .

  • Dose-Response Relationships: Determining the sensitivity of Or46a by measuring responses to increasing concentrations of active odorants.

  • Temporal Response Characteristics: Analyzing the dynamics of Or46a activation, including response onset, duration, adaptation, and recovery.

  • Electrophysiological Recordings: Using single sensillum recordings to measure the firing rate of neurons expressing Or46a in response to odorant stimulation.

  • Calcium Imaging: Visualizing calcium influx in Or46a-expressing neurons upon odorant stimulation.

  • Heterologous Expression Systems: Expressing Or46a in cell lines or Xenopus oocytes for controlled functional studies.

  • Behavioral Assays: Correlating Or46a activation with behavioral responses through attraction/avoidance assays or more complex behavioral paradigms.

What is the recommended methodology for comparing Or46a isoforms A and B?

To compare Or46a isoforms A and B effectively, researchers should employ a systematic approach that addresses both structural and functional aspects:

  • Sequence and Structural Analysis:

    • Perform detailed sequence alignment to identify specific differences between isoforms

    • Use structural prediction software to model potential structural variations

    • Identify key functional domains that might differ between isoforms

  • Expression Pattern Analysis:

    • Create isoform-specific reporter constructs to visualize expression patterns

    • Use RT-PCR or RNA-seq with isoform-specific primers to quantify relative expression levels

    • Perform in situ hybridization with isoform-specific probes to determine spatial expression patterns

  • Functional Comparison:

    • Express each isoform separately in heterologous systems

    • Compare odorant response profiles for each isoform using identical panels of odorants

    • Determine differences in sensitivity, temporal dynamics, and specificity

  • In vivo Studies:

    • Generate transgenic flies expressing only one isoform

    • Compare behavioral responses to odorants

    • Perform electrophysiological recordings to compare neuronal responses

  • Interaction Studies:

    • Investigate potential differences in interaction with Orco co-receptor

    • Examine membrane trafficking and localization differences

This methodological approach would provide comprehensive data on the structural and functional differences between Or46a isoforms A and B, leading to insights about their potentially distinct roles in olfactory perception .

How does the co-receptor dependency of Or46a compare with other odorant receptors?

The co-receptor dependency of Or46a can be analyzed in the context of the broader olfactory receptor landscape in Drosophila:

  • OR Family Co-receptor Dependency: Like other members of the OR family, Or46a requires the co-receptor Orco for proper function. This dependency is universal across the OR family, as Orco is necessary for trafficking ORs to the dendritic membrane and for forming functional ion channels.

  • Comparative Analysis with IR Family: In contrast to the OR family, the ionotropic receptor (IR) family utilizes different co-receptors (Ir25a, Ir8a, and Ir76b). Recent research has revealed extensive overlap in expression among these different co-receptors, with Ir25a being broadly expressed in 88% of identified olfactory neuron types .

  • Evolutionary Conservation: The dependency on co-receptors is evolutionarily conserved across insect species, suggesting fundamental functional importance of this arrangement.

  • Functional Implications: The co-receptor arrangement allows for a diversity of odorant specificity (determined by the variable OR) while maintaining consistent channel properties (contributed by the conserved Orco).

  • Co-expression Patterns: Recent findings challenge the traditional view that olfactory neurons express only one chemosensory receptor family. The discovery of co-expression patterns invites re-examination of odor coding models in Drosophila .

What are the key considerations for experimental design when studying Or46a function in vivo?

When designing experiments to study Or46a function in vivo, researchers should consider:

  • Genetic Background Control: Use appropriate genetic controls, as Drosophila strains can have significant genetic variation affecting olfactory responses. Consider using recombinant inbred lines (RILs) for mapping genetic effects .

  • Developmental Timing: Account for developmental changes in olfactory systems. Or46a expression and function may vary between larval and adult stages.

  • Environmental Conditions: Standardize environmental conditions (temperature, humidity, time of day) as these factors can influence olfactory responses.

  • Stimulus Delivery: Carefully control odorant delivery in terms of concentration, duration, and flow rate, as these parameters significantly affect receptor responses.

  • Physiological State: Consider the physiological state of the flies (fed vs. starved, age, sex) as these factors influence olfactory sensitivity and behavioral responses.

  • Multi-level Analysis: Combine analyses at multiple levels:

    • Molecular (receptor expression and localization)

    • Cellular (neuronal activation)

    • Circuit (antennal lobe activity patterns)

    • Behavioral (attraction, avoidance, or more complex behaviors)

  • Statistical Power: Ensure sufficient sample sizes for robust statistical analysis. The number of required replicates will depend on the variability of the measured parameter .

How should researchers analyze and interpret complex datasets from Or46a studies?

Analysis and interpretation of complex datasets from Or46a studies require sophisticated approaches:

  • Data Normalization: Normalize data appropriately to account for experimental variations and enable comparisons across different experiments or conditions.

  • Statistical Analysis Framework:

    • For electrophysiological data: Apply appropriate statistical tests for time-series data

    • For imaging data: Use spatial and temporal filtering to improve signal-to-noise ratio

    • For behavioral data: Consider using machine learning approaches for pattern recognition

  • Dose-Response Analysis: Fit appropriate models (e.g., Hill equation) to dose-response data to extract parameters such as EC50 (half-maximal effective concentration) and dynamic range.

  • Temporal Dynamics Analysis: Analyze response kinetics including onset time, time to peak, adaptation rate, and recovery time.

  • Multi-dimensional Analysis: Use principal component analysis (PCA) or other dimensionality reduction techniques to identify patterns in complex datasets.

  • Comparative Analysis: Compare Or46a responses with other odorant receptors to place findings in the broader context of the olfactory system.

  • Integration of Multiple Data Types: Develop frameworks for integrating data from different experimental approaches (e.g., electrophysiology, calcium imaging, and behavior) to create comprehensive models of Or46a function .

What data table structure is recommended for recording Or46a experimental results?

A robust data table structure for Or46a experimental results should include the following elements:

Table 1: Recommended Data Table Structure for Or46a Experimental Results

Column HeaderDescriptionUnitsMeasurement Uncertainty
Odorant IDUnique identifier for tested odorantN/AN/A
Odorant NameChemical name of the odorantN/AN/A
CAS NumberChemical Abstracts Service registry numberN/AN/A
ConcentrationConcentration of odorant testedM or μM±X%
Or46a ResponseMagnitude of receptor responseSpikes/s or ΔF/F±X units
Response LatencyTime to response onsetms±X ms
Time to PeakTime to maximum responsems±X ms
Response DurationDuration of elevated responses±X s
Control ResponseResponse in control conditionsSame as Or46a Response±X units
TemperatureExperimental temperature°C±X°C
Replicate IDIdentifier for experimental replicateN/AN/A
GenotypeGenetic background of test organismN/AN/A
Experimental SystemCell type or in vivo preparationN/AN/A

This structured approach ensures the data table:

  • Has clear column headers with appropriate units

  • Includes measurement uncertainty

  • Records all relevant experimental parameters

  • Facilitates statistical analysis and comparisons across experiments

  • Enables reproducibility of results

How can hybrid receptor approaches provide insights into Or46a function?

Hybrid receptor approaches, where domains from different species or receptor types are combined, offer powerful tools for understanding Or46a function:

  • Domain Function Identification: By creating chimeric receptors that combine domains from Or46a with those from other odorant receptors, researchers can identify which domains are responsible for specific functions such as ligand binding, signal transduction, or interaction with Orco.

  • Cross-Species Comparison: Constructing hybrid receptors combining domains from Drosophila Or46a with homologous domains from other insect species can reveal evolutionarily conserved functional elements and species-specific adaptations.

  • Humanized Drosophila Models: As demonstrated with other proteins like Orc6, creating hybrid constructs containing human and Drosophila domains can help identify the importance of evolutionary conserved and variable domains. Such approaches could be applied to Or46a to better understand olfactory receptor evolution and function .

  • Rescue Experiments: Testing whether hybrid receptors can rescue phenotypes in Or46a mutants can provide insights into which domains are sufficient for function in vivo.

  • Structure-Function Relationships: Systematic swapping of domains between Or46a and other ORs with different ligand specificities can help map the structural basis of odorant recognition.

This approach has been successfully applied to other proteins, where researchers created hybrid Drosophila-Human and Human-Drosophila constructs to study protein function and found that some hybrid constructs could fully rescue phenotypes while others could not .

What are the implications of co-receptor expression patterns for understanding Or46a function?

Recent findings about co-receptor expression patterns have significant implications for our understanding of Or46a function:

  • Challenge to Traditional Models: The discovery of extensive overlap in expression among different co-receptors challenges the traditional view that Drosophila olfactory neurons express only one chemosensory receptor gene family .

  • Complex Signaling Integration: Neurons expressing both Or46a (with its co-receptor Orco) and IR co-receptors (Ir25a, Ir8a, or Ir76b) might integrate signals from multiple chemosensory pathways, enabling more complex olfactory coding than previously thought.

  • Expanded Response Profiles: Co-expression of multiple receptor types could expand the response profile of individual neurons, allowing them to detect and respond to a broader range of odorants.

  • Modulatory Interactions: Co-receptors from different families might modulate each other's function, potentially affecting Or46a sensitivity, specificity, or temporal dynamics.

  • Developmental and Regulatory Insights: Understanding the regulatory mechanisms that govern co-expression patterns could provide insights into the development and evolution of the olfactory system.

These findings invite a re-examination of odor coding models in Drosophila and other insects, suggesting more complex combinatorial processing than previously appreciated .

How might toxicogenomic approaches contribute to understanding Or46a regulation and function?

Toxicogenomic approaches can provide valuable insights into Or46a regulation and function:

  • Gene-Environment Interactions: By exposing Drosophila to various toxicants and measuring changes in Or46a expression, researchers can identify environmental factors that regulate this receptor and potentially understand mechanisms of olfactory plasticity.

  • Regulatory Network Identification: Toxicogenomic studies using recombinant inbred lines (RILs) can identify trans-eQTLs (expression quantitative trait loci) that influence Or46a expression in response to environmental challenges. This approach has been successful in identifying master-modulatory genes in lead toxicity studies .

  • Functional Consequences of Exposure: Examining how toxicant exposure affects Or46a-mediated behaviors can reveal the functional significance of gene expression changes.

  • Developmental Vulnerability: Studying the effects of toxicant exposure during different developmental windows can identify critical periods when Or46a development is most vulnerable.

  • Cross-Generational Effects: Investigating whether toxicant exposure in parents affects Or46a expression or function in offspring can reveal epigenetic mechanisms of regulation.

  • Protective Mechanisms: Identifying genetic variants that confer resistance to toxicant-induced changes in Or46a function could reveal protective mechanisms and contribute to our understanding of olfactory system resilience.

These approaches can leverage the genetic tractability of Drosophila and the wealth of available genomic tools to provide insights that may be relevant not only to insect biology but also to understanding chemosensory systems more broadly .

What are the most significant unresolved questions regarding Or46a function?

Despite advances in understanding Drosophila odorant receptors, several significant questions about Or46a remain unresolved:

  • Isoform-Specific Functions: The functional differences between Or46a isoforms (A and B) and their potential distinct roles in olfactory perception remain poorly understood.

  • Structural Basis of Ligand Specificity: The precise structural elements that determine Or46a's odorant specificity and the molecular mechanisms of ligand binding are not fully elucidated.

  • Integration with Other Sensory Modalities: How Or46a-mediated olfactory information is integrated with other sensory inputs (gustatory, visual, mechanosensory) to guide complex behaviors needs further investigation.

  • Developmental Regulation: The mechanisms controlling Or46a expression during development and the factors determining which neurons express this receptor are not completely understood.

  • Plasticity Mechanisms: How Or46a function is modulated by experience, physiological state, or environmental factors, and the molecular mechanisms underlying this plasticity require further study.

  • Circuit-Level Processing: The precise connectivity and processing of Or46a signals within the antennal lobe and higher brain centers remain to be fully mapped.

Addressing these questions will require integrative approaches combining molecular, genetic, physiological, and behavioral techniques .

How might new technologies advance our understanding of Or46a and other odorant receptors?

Emerging technologies are poised to significantly advance our understanding of Or46a and other odorant receptors:

  • Cryo-EM and Advanced Structural Biology: These techniques may finally reveal the three-dimensional structure of insect odorant receptors, including Or46a, providing crucial insights into receptor function and ligand binding.

  • CRISPR-Based Approaches: Enhanced genome editing techniques allow for more precise manipulation of Or46a, including insertion of reporter genes at endogenous loci, creation of conditional knockouts, and introduction of specific mutations.

  • Single-Cell Multi-Omics: Combining transcriptomics, proteomics, and epigenomics at the single-cell level can provide comprehensive profiles of neurons expressing Or46a and reveal cell-type-specific regulatory mechanisms.

  • Advanced Imaging Techniques: Super-resolution microscopy and improved calcium indicators allow for more detailed visualization of Or46a localization and activity in living neurons.

  • Connectomics: Electron microscopy-based reconstruction of neural circuits can reveal the precise connectivity of Or46a-expressing neurons within the olfactory system.

  • Optogenetics and Chemogenetics: These techniques enable precise temporal control of Or46a-expressing neurons, allowing researchers to dissect their role in circuit function and behavior.

  • Computational Modeling: Advanced modeling approaches can integrate diverse data types to predict Or46a responses to novel odorants and understand its role in the broader olfactory coding scheme .

What interdisciplinary approaches might yield new insights into Or46a function and application?

Interdisciplinary approaches hold great promise for advancing our understanding of Or46a:

  • Evolutionary Biology and Comparative Genomics: Comparing Or46a across Drosophila species and other insects can reveal evolutionary patterns and functional adaptations.

  • Computational Chemistry and Structural Biology: Combining molecular dynamics simulations with experimental data can provide insights into Or46a-ligand interactions and guide the design of receptor-specific compounds.

  • Systems Biology and Network Analysis: Placing Or46a in the context of broader gene regulatory and protein interaction networks can reveal unexpected connections and regulatory mechanisms.

  • Engineering and Synthetic Biology: Creating synthetic olfactory systems incorporating modified versions of Or46a could lead to novel biosensors for environmental monitoring or disease diagnosis.

  • Neuroscience and Behavior: Integrating studies of Or46a function with broader investigations of neural circuit function and behavior can reveal how molecular-level events translate into organismal responses.

  • Ecological and Field Studies: Understanding the role of Or46a in Drosophila's natural environment can provide context for laboratory findings and reveal ecologically relevant functions.

  • Translational Research: Insights from Or46a studies might inform approaches to controlling insect vectors of disease or agricultural pests through manipulation of olfactory systems.

These interdisciplinary approaches can leverage diverse expertise and methodologies to address complex questions about Or46a function that cannot be resolved through single-discipline approaches alone .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.