Recombinant Drosophila melanogaster Odorant receptor 47a (Or47a)

Shipped with Ice Packs
In Stock

Description

Introduction to Odorant Receptors in Drosophila melanogaster

The sense of smell is vital for Drosophila melanogaster's survival, enabling critical behaviors including food location, mate selection, predator avoidance, and environmental danger detection . The molecular foundation of olfaction in Drosophila involves three primary families of chemosensory receptors: odorant receptors (ORs), ionotropic receptors (IRs), and gustatory receptors (GRs) . These receptors bind odorant molecules from the environment, triggering the activation of olfactory sensory neurons (OSNs) that transmit this information to the antennal lobes in the fly brain .

Odorant receptors constitute a major class of these chemosensory proteins, with approximately 60 OR genes identified in Drosophila melanogaster . A distinctive feature of the OR family is their dependence on a universal co-receptor called Orco, which is essential for proper receptor trafficking to the dendritic membrane and formation of functional ion channels . Without Orco, the OR proteins cannot form functional receptor complexes, rendering the neurons incapable of responding to their cognate odorants .

Organizational Principles of Olfactory Reception

The traditional understanding of Drosophila olfaction has been that individual olfactory neurons express receptors from only one chemosensory gene family (either ORs, IRs, or GRs) . Neurons expressing the same receptor—considered an OSN class—project their axons to specific regions in the antennal lobe called glomeruli . This creates a sensory map where the domains for OR+, IR+, and GR+ neurons are segregated, with OR+ domains innervating 38 anterior glomeruli, while IR+ and GR+ domains occupy more posterior portions .

Functional Integration in the Olfactory System

Or47a-expressing neurons constitute a specific OSN class that projects to a dedicated glomerulus in the antennal lobe . This organization follows the "one receptor-one neuron-one glomerulus" principle that has been the canonical model in Drosophila olfaction, though recent findings about co-receptor expression patterns suggest a more complex arrangement than previously recognized .

Production and Characteristics of Recombinant Or47a

Recombinant Drosophila melanogaster Odorant receptor 47a (Or47a) refers to the artificially produced version of the naturally occurring Or47a protein. This recombinant protein enables researchers to study the receptor's properties and functions outside the native cellular environment.

Reconstitution Protocol

For optimal use, the following reconstitution protocol is recommended:

  1. Briefly centrifuge the vial before opening to bring contents to the bottom

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (default recommendation is 50%)

  4. Aliquot for long-term storage at -20°C/-80°C

Role of Or47a in Olfactory Processing

While the search results don't provide specific information about the odorants detected by Or47a, we can contextualize its function within the broader understanding of odorant receptors in Drosophila. ORs in general are involved in detecting various classes of odorants including esters, aromatics, and other general odorants .

Odorant Detection Mechanism

The mechanism by which ORs detect odorants involves:

  1. Odorant molecules entering the sensilla from the environment

  2. Binding to specific receptor proteins (such as Or47a/Orco complexes)

  3. Activating the olfactory sensory neurons

  4. Transmitting this information to the antennal lobes in the fly brain

The specificity of an OR like Or47a for certain odorants is crucial for the fly's ability to discriminate between different environmental chemicals. This selectivity helps the insect navigate its chemical environment effectively.

Research Applications of Recombinant Or47a

Recombinant Or47a has numerous potential applications in both basic and applied research.

Ligand Screening and Characterization

Similar to studies with odorant binding proteins like OBP28a, recombinant Or47a could be used in fluorescent binding assays to screen potential ligands and determine binding affinities . Such approaches might identify new compounds that interact with Or47a, potentially revealing its natural ligands and activation profile.

Comparative Olfactory Research

The study of specific ORs like Or47a enables comparative analyses across:

  1. Different olfactory receptor types within Drosophila

  2. Homologous receptors across insect species

  3. Evolutionary relationships between insect and vertebrate olfactory systems

Future Directions in Or47a Research

Several promising research directions could advance our understanding of Or47a and its role in olfaction.

Integration with Co-receptor Expression Studies

Recent findings about co-expression of different chemoreceptor families challenge the traditional view of segregated expression . Future research could investigate whether Or47a-expressing neurons also express other chemoreceptor types and how this impacts their response profiles.

Development of Or47a-Based Biosensors

The specificity of Or47a for certain odorants could potentially be leveraged to develop biosensors for detecting specific compounds in environmental or industrial applications. Similar approaches with other olfactory proteins have shown promise in creating highly selective detection systems.

Genetic Manipulation Studies

Genetic deletion or modification of the Or47a gene, similar to studies performed with OBP28a , could reveal its specific role in olfactory behavior and electrophysiological responses to particular odorants. Such functional studies would complement the structural and biochemical approaches enabled by recombinant protein production.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please specify it in your order. We will prioritize your request and attempt to include the specified tag in the production process.
Synonyms
Or47a; AN10; dor24; DOR47E.1; Or47E.1; CG13225; Odorant receptor 47a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-385
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or47a
Target Protein Sequence
MDSFLQVQKSTIALLGFDLFSENREMWKRPYRAMNVFSIAAIFPFILAAVLHNWKNVLLL ADAMVALLITILGLFKFSMILYLRRDFKRLIDKFRLLMSNEAEQGEEYAEILNAANKQDQ RMCTLFRTCFLLAWALNSVLPLVRMGLSYWLAGHAEPELPFPCLFPWNIHIIRNYVLSFI WSAFASTGVVLPAVSLDTIFCSFTSNLCAFFKIAQYKVVRFKGGSLKESQATLNKVFALY QTSLDMCNDLNQCYQPIICAQFFISSLQLCMLGYLFSITFAQTEGVYYASFIATIIIQAY IYCYCGENLKTESASFEWAIYDSPWHESLGAGGASTSICRSLLISMMRAHRGFRITGYFF EANMEAFSSIVRTAMSYITMLRSFS
Uniprot No.

Target Background

Function
Odorant receptor 47a (Or47a) is a protein in Drosophila melanogaster that mediates acceptance or avoidance behavior in response to odor stimuli. This receptor functions by detecting a wide range of odors, varying in their identity, intensity, and duration. Or47a forms a complex with Orco (odorant receptor co-receptor) to create odorant-sensing units, enabling sensitive and prolonged odorant signaling, as well as calcium permeability. These complexes are crucial for functional reconstitution of odor-evoked signaling in sensory neurons that normally respond only to carbon dioxide. Or47a plays a significant role in the behavioral responses to esters and pentyl acetate.
Gene References Into Functions
  1. The or47a neuron primarily projects to the DM3 glomerulus with minor projections to the DL3, DM5, and DM4 glomeruli. PMID: 12555270
Database Links

KEGG: dme:Dmel_CG13225

STRING: 7227.FBpp0087212

UniGene: Dm.2583

Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or1a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed with Orco in 40 olfactory receptor neurons in a broad area across the antenna, including both anterior and posterior faces. This expression pattern matches the distribution of the small sensilla basiconica. Expression in the antenna is observed

Q&A

What is the molecular structure of Drosophila melanogaster Or47a and how does it function in the olfactory system?

Or47a belongs to the odorant receptor (OR) family in Drosophila melanogaster. Like other ORs, it requires the co-receptor Orco for proper function, forming a heteromeric complex that acts as a ligand-gated ion channel. This complex directly transduces odor stimuli into electrical signals in olfactory receptor neurons (ORNs) . Structurally, ORs in Drosophila have an inverted membrane topology compared to mammalian G-protein coupled receptors (GPCRs), with an intracellular N-terminus and extracellular C-terminus.

How is Or47a expression regulated in Drosophila melanogaster?

Or47a expression, like other ORs, is likely regulated by both developmental and hormonal factors. Research on similar receptors such as Or47b has shown that expression levels can increase with age and can be upregulated by juvenile hormone signaling . Specifically, exposure to the juvenile hormone analog methoprene has been demonstrated to increase expression of some ORs, suggesting potential hormonal regulation of Or47a as well .

What expression systems are most effective for recombinant Or47a studies?

For heterologous expression of Or47a, several key components must be considered:

  • Co-expression with Orco: Always co-express Or47a with the universal co-receptor Orco, as it is essential for proper receptor function .

  • Expression vector selection: Using bacterial artificial chromosome (BAC) vectors containing open chromatin regions (like BAC Rosa26) may provide more stable and higher-level expression compared to conventional expression vectors .

  • Cell line optimization: Multiple cell lines have been developed for OR expression studies. To ensure stable expression, include fluorescent markers like mCherry to track receptor expression and GCaMP6 as a calcium indicator for functional assays .

  • Trafficking enhancement: Consider using signal peptide tags to enhance OR release from the endoplasmic reticulum and trafficking to the plasma membrane, which can significantly improve calcium response intensity in OR-transfected cells .

How can I optimize single-sensillum recording protocols for Or47a-expressing neurons?

For accurate electrophysiological measurements of Or47a neurons:

  • Electrode positioning: Target the specific sensilla housing Or47a-expressing ORNs based on antennal lobe innervation maps.

  • Control for experimental order effects: When testing multiple stimuli or conditions, be mindful that the ordering of experiments in repeated-measure designs can affect outcomes. Consider both ascending and descending stimulus intensity orders to control for adaptation effects .

  • Recording analysis: For spike frequency analysis, standardize the measurement window (typically 500ms) after stimulus onset. Compare only second epochs of responses when measuring across multiple time points to eliminate potential bias seen in first-epoch measurements .

What tools and techniques are available for functional manipulation of Or47a-expressing neurons?

Several genetic tools can be employed:

  • Optogenetic activation: Use Or-Gal4 > UAS-CsChrimson for light-controlled activation of Or47a neurons. Carefully calibrate light intensity to evoke physiologically relevant spike rates .

  • Partial population manipulation: SPARC technology (SPARC2-D-CsChrimson combined with Or-Gal4) can be used to manipulate defined subsets of ORNs to study population size effects on behavior .

  • RNAi knockdown: Targeted gene knockdown can be achieved using RNAi constructs expressed specifically in Or47a neurons to study receptor function or associated signaling components .

How do G-protein signaling pathways interact with Or47a-mediated responses?

While Drosophila ORs primarily function as ligand-gated ion channels, G-protein signaling also plays an important role in olfactory response:

  • G-protein contribution: Go signaling specifically has been demonstrated to contribute to olfactory reception in Drosophila. Inhibition of Go using pertussis toxin reduces the amplitude and hastens the termination of olfactory responses .

  • Dual signaling pathways: OR activation appears to engage both direct ionotropic signaling and G-protein mediated metabotropic signaling for optimal responses. A given odorant may activate multiple transduction pathways, with both OR channel function and G-protein signaling (including Go and Gq) required for maximal physiological response .

  • Experimental approach: To study G-protein contributions to Or47a signaling, express pertussis toxin conditionally in Or47a neurons and measure electroantennogram responses. The effect of pertussis toxin appears independent of odorant identity and intensity, suggesting a generalized involvement of Go in olfactory reception .

What mechanisms are involved in the amplification of Or47a-mediated signals?

Signal amplification in ORNs occurs through several mechanisms:

  • DEG/ENaC channel involvement: Pickpocket 25 (PPK25), a member of the degenerin/epithelial sodium channel family (DEG/ENaC), mediates Ca²⁺-dependent signal amplification in some ORNs. While specifically demonstrated for Or47b neurons, similar mechanisms may operate in Or47a neurons .

  • Calmodulin binding: The amplification mechanism likely involves an intracellular calmodulin-binding motif on PPK25 .

  • Hormonal regulation: Juvenile hormone signaling can upregulate amplification components like PPK25, with age-dependent effects on receptor sensitivity .

  • Testing amplification: When studying potential amplification mechanisms for Or47a, consider age-dependent effects and hormonal status of experimental animals, as these factors significantly affect olfactory response magnitude .

How should contradictory results between in vitro and in vivo Or47a studies be reconciled?

When facing discrepancies between heterologous expression systems and in vivo recordings:

  • Expression level differences: In heterologous systems, receptor expression levels may differ significantly from natural ORNs. Quantify receptor expression using fluorescent tags or qPCR to normalize responses .

  • Missing auxiliary factors: In vivo neurons may contain additional signaling components absent in heterologous systems. For example, PPK25 provides signal amplification in some ORNs but may not be present in cell culture systems .

  • Experimental design considerations: The experimental order can significantly affect results, particularly in repeated-measure designs. Always include appropriate controls and consider the potential for adaptation or sensitization effects .

  • Co-receptor interactions: Recent evidence shows that Drosophila olfactory neurons may express multiple receptor types and co-receptors, contrary to the traditional "one neuron-one receptor" model . Check for potential co-expression of other receptors with Or47a that might influence signaling.

What controls should be included when studying receptor specificity and sensitivity?

Essential controls include:

  • Receptor-null controls: Use Or47a mutant or RNAi knockdown flies to establish baseline responses in the absence of the receptor.

  • Co-receptor controls: Include Orco mutant controls to verify Orco-dependency of responses.

  • Orthogonal receptor controls: Test receptors known not to respond to your odorants of interest, such as Or22a neurons which can serve as negative controls when they don't express the signaling component being studied .

  • Stimulus intensity controls: Generate complete dose-response curves rather than single-concentration measurements to accurately characterize receptor sensitivity.

  • Age-matched controls: Given the age-dependent plasticity in olfactory responses, always use age-matched flies for comparisons .

How can optogenetic approaches be optimized for Or47a functional characterization?

For effective optogenetic manipulation:

  • Light intensity calibration: Determine the light intensity evoking equivalent spike rates to natural odor stimuli through electrophysiological recordings before behavioral experiments .

  • Lateralized stimulation: To mimic naturalistic odor encounter, focus light beams on one antenna for lateralized optogenetic activation, which has been shown to evoke direction-specific behaviors .

  • Pulse protocols: Use pulsed optogenetic activation to better mimic temporal dynamics of natural odor plumes. Note that pulsed activation may not evoke identical time-locking of responses as odors but can still induce similar behavioral outcomes .

  • Population size effects: Consider that the number of activated neurons significantly impacts behavioral outcomes. Using SPARC technology to activate subsets of Or47a neurons can help determine the minimum population size required for behavioral responses .

How does co-expression of multiple receptor types impact Or47a signaling?

Recent findings challenge the traditional view of "one neuron-one receptor":

  • Co-receptor expression patterns: Extensive overlap exists in co-receptor expression, with Ir25a broadly expressed in 88% of all olfactory sensory neuron classes and co-expressed in 82% of Orco+ neuron classes .

  • Functional implications: This co-expression may enable integration of signals through multiple chemosensory pathways within a single neuron, potentially allowing for more complex odor coding .

  • Experimental approach: When studying Or47a function, consider possible co-expression with ionotropic receptors (IRs) or other receptor types that might modulate responses. Use co-receptor knock-in strategies to map expression patterns accurately .

  • Evolutionary perspective: Co-expression of chemosensory receptors appears to be common across insect species, including Drosophila sechellia and Anopheles coluzzii, suggesting evolutionary conservation of this feature .

Why might heterologous expression of Or47a result in poor membrane localization or function?

Common problems and solutions include:

  • ER retention: Odorant receptors may be retained in the endoplasmic reticulum. The use of signal peptide tags has been shown to significantly enhance OR release from the ER and trafficking to the plasma membrane .

  • Co-receptor requirements: Ensure adequate co-expression of Orco, which is essential for proper trafficking and function of ORs .

  • Expression vector limitations: Consider using bacterial artificial chromosome (BAC) vectors containing open chromatin regions rather than conventional expression vectors, as these provide more stable and higher-level expression .

  • Cell line selection: Different cell lines have varying abilities to properly express functional ORs. Test multiple cell lines to identify optimal expression systems for Or47a .

How can age-dependent variability in Or47a responses be controlled in experiments?

Age-dependent plasticity has been observed in multiple ORN types:

  • Standardize age: Use precisely age-matched flies for all experiments (e.g., all 7-day old or all 2-day old) .

  • Hormonal status: Control for juvenile hormone levels, as they can significantly affect OR expression and function. Consider the potential effects of rearing conditions that might influence hormone levels .

  • Molecular markers: Monitor expression levels of key components like PPK25 that show age-dependent upregulation and mediate signal amplification .

  • Internal controls: Include age-independent ORN types (such as Or22a neurons that do not exhibit age-dependent plasticity) as internal controls when studying age-related effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.