Recombinant Drosophila melanogaster Opsin Rh2 (Rh2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Drosophila melanogaster Opsin Rh2 (Rh2) is a light-sensitive G protein-coupled receptor (GPCR) expressed in ocellar photoreceptor cells of fruit flies. It forms the protein component of rhodopsin pigments essential for converting light signals into neural responses . The recombinant version is produced in heterologous systems like E. coli for biochemical and functional studies .

Production Methods

Recombinant Rh2 is typically expressed in E. coli with an N-terminal His tag for purification. Challenges include low yield and instability, addressed by:

  • C-Terminal Modifications: Substituting Rh2’s C-terminus with honeybee UV opsin sequences improves stability .

  • Purification: Affinity chromatography followed by gel filtration yields >90% purity .

Expression Systems Comparison

ParameterE. coli Mammalian Cells
YieldModerate (~20% vs. bovine rhodopsin)Low
StabilityRequires glycerol buffers Higher endogenous activity
CostLowHigh

Functional Characteristics

  • Spectral Properties: Forms UV-sensitive pigments (λmax = 350 nm) with a broad absorption spectrum extending to 500 nm .

  • G Protein Coupling: Activates Gq proteins upon UV irradiation, enabling signal transduction .

  • Promoter Analysis: Regulatory sequences between -183 and -112 bp upstream of the transcription start site are essential for ocellar-specific expression .

Research Applications

Recombinant Rh2 is pivotal for:

  1. Photoreceptor Studies: Investigating ocellar phototransduction mechanisms .

  2. Circadian Rhythm Research: Related opsins (e.g., Rh7) influence non-visual light sensing, providing comparative insights .

  3. Structural Biology: Mapping retinal-binding sites and GPCR activation dynamics .

Key Research Findings

  • Promoter Activity: Rh2 promoter-driven reporter genes (e.g., CAT, lacZ) confirm ocellar-specific expression, validated via histochemical staining and ocelliless mutant studies .

  • Bistable Photochemistry: UV light converts Rh2 to a metarhodopsin state (active Gq-coupled form), reversible by visible light .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please communicate this need in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by numerous factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize fulfilling your request.
Synonyms
Rh2; CG16740; Opsin Rh2; Ocellar opsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-381
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Rh2
Target Protein Sequence
MERSHLPETPFDLAHSGPRFQAQSSGNGSVLDNVLPDMAHLVNPYWSRFAPMDPMMSKIL GLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYY ETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKILFI WMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNPRSYLITYSLFVYYTPLFLICYS YWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTISLWFMAWTPYL VICYFGLFKIDGLTPLTTIWGATFAKTSAVYNPIVYGISHPKYRIVLKEKCPMCVFGNTD EPKPDAPASDTETTSEADSKA
Uniprot No.

Target Background

Function
Visual pigments are the light-absorbing molecules responsible for vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Database Links

KEGG: dme:Dmel_CG16740

STRING: 7227.FBpp0083111

UniGene: Dm.2404

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Predominant opsin expressed in the dorsal ocelli.

Q&A

What is Drosophila melanogaster Opsin Rh2 and where is it expressed?

Rh2 is one of seven rhodopsin genes in Drosophila melanogaster that encodes the protein component of a rhodopsin specifically expressed in ocellar photoreceptor cells. Unlike other rhodopsins that function in the compound eye, Rh2 is uniquely expressed in the ocelli, which are simple eyes found on the dorsal surface of the fly head. The Rh2 rhodopsin provides violet-sensing capability in Drosophila ocelli, contributing to their distinct spectral sensitivity compared to the compound eye . This tissue-specific expression pattern makes Rh2 an excellent model for studying the molecular basis of photoreceptor cell differentiation and specialization in insects.

How does Rh2 differ functionally from other Drosophila rhodopsins?

Among Drosophila's seven rhodopsin genes (Rh1-7), each has evolved distinct spectral sensitivities and expression patterns. While Rh1-6 have been well-characterized as visual pigments in ocelli and compound eyes, Rh2 specifically provides violet-sensing capability in the ocelli, contributing to their unique spectral sensitivity and function . This specialization allows ocelli to perform different visual functions than the compound eye. Unlike Rh7, which functions as a circadian photoreceptor in the brain, Rh2 serves primarily in visual perception through the ocelli . The exclusive presence of Rh2 in ocelli but not in the retina underlies the functional differences between these visual organs, with ocelli potentially serving roles in light detection for flight stabilization and orientation.

What are the key structural features of the Rh2 gene and promoter region?

The Rh2 gene's regulatory region has been extensively characterized through promoter analysis studies. A critical region for head-specific expression has been identified extending from -183 to -112 base pairs upstream of the transcription start site . The minimal promoter region of Rh2 (-293/+55) contains three potential binding sites for the homeodomain transcription factor Homothorax (Hth): one within the coding sequence of the neighboring gene CG14297, another directly following its stop codon, and a third within its 3'UTR . DNA sequence analysis of the Rh2 promoter from -448 to +32 revealed an 11-bp sequence that is also present in upstream flanking sequences of two other photoreceptor-specific genes (ninaE and ninaC), suggesting common regulatory mechanisms across photoreceptor genes . Interestingly, a portion of the Rh2 minimal promoter sequence overlaps with the coding sequence of the neighboring gene CG14297, highlighting the compact nature of the Drosophila genome .

How is Rh2 expression regulated during development?

Rh2 expression is tightly regulated by specific transcription factors during Drosophila development. The homeodomain transcription factor Homothorax (Hth) plays a critical role in controlling Rh2 expression specifically in ocellar photoreceptors . Hth, which is expressed in ocellar photoreceptors, functions as part of a binary rhodopsin switch mechanism that simultaneously promotes Rh2 expression while repressing Rh1 expression in ocelli . This regulatory mechanism ensures proper rhodopsin patterning during terminal differentiation of ocellar photoreceptors. The temporal dynamics of Hth expression are significant, as it is initially expressed in the ocellar primordium during early third instar larval (L3) development but gets downregulated later at mid to late L3 stages . This precise temporal control likely contributes to the proper timing of rhodopsin expression during ocelli development.

What transcription factors control Rh2 expression and how do they function?

Homothorax (Hth) is the primary transcription factor identified in controlling Rh2 expression. Hth acts in concert with Extradenticle (Exd) to regulate a binary rhodopsin switch in ocelli that promotes Rh2 expression while repressing Rh1 expression . Genetic and molecular analyses indicate that this rhodopsin switch is transcriptionally controlled by Hth, which may act directly through the Rh1 and Rh2 promoter sequences . The Rh2 minimal promoter contains three potential Hth binding sites, suggesting direct transcriptional regulation. Interestingly, while Hth maintains Rh3 fate in the dorsal rim area (DRA) of the compound eye, it initiates Rh2 fate in the ocelli, demonstrating its context-dependent functions in different photoreceptor types . This dual role highlights the versatility of transcription factors in establishing distinct cellular identities across tissues.

What is the role of the 11-bp conserved sequence in the Rh2 promoter?

An 11-bp sequence identified within the Rh2 promoter region is also present in the upstream flanking sequences of two other photoreceptor-specific genes (ninaE and ninaC) . This conserved element likely plays a crucial role in coordinating the expression of multiple photoreceptor genes. The presence of this shared sequence suggests a common regulatory mechanism that may recruit similar transcription factors or cofactors to activate these genes specifically in photoreceptor cells. The functional significance of this conserved element has been demonstrated through promoter analysis studies, where fragments containing this sequence conferred head-specific expression patterns when fused to reporter genes . This element may serve as a binding site for photoreceptor-specific transcription factors or function as an enhancer element that mediates tissue-specific expression in the visual system of Drosophila.

How can recombinant Rh2 be effectively produced for in vitro studies?

While the search results don't provide specific methods for Rh2 recombinant production, we can infer approaches based on successful recombinant expression of other Drosophila opsins. For Rh2 recombinant protein production, researchers could employ mammalian cell expression systems similar to those used for Rh7 expression . This typically involves:

  • Cloning the full-length Rh2 cDNA into a mammalian expression vector containing appropriate promoters and selection markers

  • Transfecting the construct into mammalian cell lines (e.g., HEK293, COS-7) optimized for membrane protein expression

  • Supplying the chromophore (11-cis-retinal) exogenously to form the functional photopigment

  • Purifying the recombinant protein using affinity tags (His-tag or FLAG-tag)

  • Verifying protein integrity through Western blotting and spectroscopic analysis

This approach would allow researchers to produce sufficient quantities of functional Rh2 for biochemical and biophysical characterization, including spectroscopic analysis to determine its absorption profile.

What promoter constructs are most effective for studying Rh2 expression patterns?

For studying Rh2 expression patterns, researchers have successfully used DNA fragments containing the start point of transcription of the Rh2 gene fused to reporter genes such as Escherichia coli chloramphenicol acetyltransferase (CAT) or lacZ (β-galactosidase) . Promoter constructs containing between 4.3 kb and 183 bp upstream of the transcription start site plus the first 32 bp of the 5'-untranslated leader have been found to result in nearly identical levels of head-specific expression . The minimal functional promoter region extends from -183 to -112 bp, as deletion of sequences distal to position -112 bp resulted in loss of detectable expression . For optimal results in transgenic studies, the Rh2 minimal promoter region (-293/+55) should be considered, as it contains the essential regulatory elements including Hth binding sites . These constructs can be introduced into the Drosophila germline by P-element-mediated transformation to study the spatial and temporal patterns of Rh2 expression during development.

What techniques can be used to analyze Rh2 expression in tissue samples?

Several complementary techniques have been employed to analyze Rh2 expression in Drosophila tissues:

  • Reporter Gene Assays: Fusion of Rh2 promoter fragments to reporter genes like CAT or lacZ allows for quantitative and spatial analysis of expression patterns . CAT assays provide quantitative measurements of promoter activity, while histochemical staining of β-galactosidase provides visualization of spatial expression patterns.

  • Histochemical Staining: β-galactosidase expressed under the control of the Rh2 promoter can be visualized through histochemical staining to determine the precise cellular localization of Rh2 expression .

  • Genetic Approaches: Analyzing the effect of mutations (such as ocelliless) on the expression of Rh2/reporter fusion genes helps confirm the tissue-specific activity of the promoter .

  • RNA in situ Hybridization: This technique can be employed to visualize Rh2 mRNA expression patterns in tissue sections, similar to approaches used for other opsins .

These methodologies provide complementary data on both the quantitative levels and spatial patterns of Rh2 expression during development and in adult tissues.

How can CRISPR-Cas9 be utilized to study Rh2 function in Drosophila?

CRISPR-Cas9 genome editing offers powerful approaches for investigating Rh2 function in vivo:

  • Precise Gene Modifications: Researchers can create point mutations in the Rh2 coding sequence to alter specific amino acids involved in spectral tuning or G-protein interaction, allowing structure-function analysis.

  • Promoter Editing: The identified Hth binding sites in the Rh2 promoter (-293/+55) could be specifically mutated to assess their individual contributions to expression regulation . This would help dissect the molecular mechanisms of the rhodopsin binary switch controlled by Hth.

  • Fluorescent Tagging: Endogenous tagging of Rh2 with fluorescent proteins would enable real-time visualization of protein expression, trafficking, and turnover in living tissues.

  • Conditional Knockouts: Creating conditional Rh2 knockout flies would allow temporal control over gene inactivation, helping distinguish developmental versus physiological roles.

  • Transcription Factor Binding Site Validation: CRISPR-based approaches could be used to validate the functionality of the conserved 11-bp sequence shared with ninaE and ninaC by creating precise deletions or substitutions .

These genome editing strategies would significantly advance our understanding of Rh2 function beyond what conventional genetic approaches have revealed.

What insights can comparative studies of Rh2 across Drosophila species provide?

Comparative analysis of Rh2 across Drosophila species could reveal important evolutionary insights:

  • Sequence Conservation: Analysis of coding sequence conservation would identify functionally critical residues that have been maintained through evolutionary pressure.

  • Promoter Evolution: Examining the conservation of the identified Hth binding sites and the 11-bp shared sequence element across species would reveal the evolutionary stability of these regulatory mechanisms .

  • Expression Pattern Divergence: Comparing the spatial and temporal expression patterns of Rh2 across species could identify shifts in visual system organization and specialization.

  • Functional Adaptation: Species living in different light environments might show adaptations in Rh2 spectral properties, providing insights into the molecular basis of visual ecology.

  • Regulatory Network Evolution: The evolutionary relationship between Hth and Rh2 regulation across species could reveal how transcriptional networks evolve while maintaining functional outputs .

Such comparative approaches would contribute to our understanding of how visual systems evolve and adapt to different ecological niches through modifications of both coding and regulatory sequences.

How does Rh2 interact with G-proteins for signal transduction?

While the search results don't provide specific information about Rh2's G-protein interactions, we can infer likely mechanisms based on research on related opsins. Rhodopsins typically activate specific G-protein subtypes upon light activation. For Drosophila Rh2, the signaling pathway likely involves:

  • G-protein Coupling: Like other insect opsins, Rh2 probably couples to a Gq-type G-protein, similar to Rh7 which was shown to activate Gq-type G proteins upon light stimulation .

  • Signal Amplification: Upon photon absorption, Rh2 likely undergoes a conformational change that activates the associated G-protein, triggering a signaling cascade involving phospholipase C activation, IP3 production, and calcium release.

  • Metarhodopsin State: Light absorption likely converts Rh2 to a metarhodopsin state that can be photoconverted back to the original state, establishing a bistable photopigment system similar to that observed for Rh7 .

  • Deactivation Mechanisms: The signaling would be regulated by rhodopsin kinases and arrestins that control the duration of G-protein activation.

Experimental approaches to study these interactions could include in vitro G-protein activation assays with purified recombinant Rh2, FRET-based interaction studies, and electrophysiological recordings from ocellar photoreceptors in wild-type versus Rh2 mutant flies.

What are common challenges in recombinant Rh2 expression and how can they be addressed?

Based on experience with similar membrane proteins, several challenges may arise when expressing recombinant Rh2:

Table 1: Common Challenges and Solutions in Recombinant Rh2 Expression

ChallengePotential CausesOptimization Strategies
Low expression levelsProtein toxicity, poor codon usage, inefficient promoterUse inducible expression systems, codon optimization for host cells, test different promoters
Misfolding/aggregationImproper membrane insertion, absence of chaperonesLower expression temperature, add chemical chaperones, use specialized cell lines
Poor chromophore bindingImproper protein folding, limited chromophore availabilitySupply excess 11-cis-retinal, optimize incubation conditions, ensure proper protein folding
Protein instabilityProteolytic degradation, thermal instabilityAdd protease inhibitors, optimize buffer conditions, add stabilizing agents
Poor solubilizationInadequate detergent selectionScreen multiple detergents, test various detergent concentrations, try lipid nanodiscs

Researchers should systematically address these challenges through careful optimization of expression conditions, including cell type selection, temperature control, and post-translational modifications to maximize functional protein yield.

How can the spectral properties of recombinant Rh2 be accurately measured?

To accurately characterize the spectral properties of recombinant Rh2:

  • UV-Visible Spectroscopy: This standard technique would measure the absorption spectrum of purified Rh2 in detergent micelles or reconstituted into lipid vesicles. Based on its role in ocelli, Rh2 likely has peak sensitivity in the violet range of the spectrum .

  • Difference Spectroscopy: Measuring the difference spectrum before and after photobleaching can provide insights into the spectral shifts between the dark state and metarhodopsin state.

  • Chromophore Analysis: Determine whether Rh2 preferentially binds 11-cis-retinal or 11-cis-3-hydroxyretinal by HPLC analysis of extracted chromophores, similar to approaches used for Rh7 .

  • pH Dependency: Examining spectral properties under varying pH conditions can reveal important insights about protonation states of key residues involved in spectral tuning.

  • Temperature Effects: Measuring thermal stability through temperature-dependent spectroscopy can provide information about protein stability and conformational flexibility.

These spectroscopic analyses would provide fundamental insights into the biophysical properties of Rh2 and how they relate to its function in ocellar photoreception.

What are promising avenues for future Rh2 research?

Several promising research directions could advance our understanding of Rh2:

  • Structural Biology: Determining the three-dimensional structure of Rh2 through X-ray crystallography or cryo-electron microscopy would provide insights into its spectral tuning mechanisms and G-protein interaction surfaces.

  • Optogenetic Applications: Rh2's unique spectral properties could make it valuable for optogenetic applications, potentially providing a violet-sensitive tool for neural control.

  • Comparative Genomics: Broader phylogenetic analysis across insect orders could reveal how Rh2 evolved and adapted to different visual ecologies.

  • Protein Engineering: Creating chimeric opsins that combine domains from Rh2 with other opsins could help identify regions responsible for specific functional properties.

  • Interactome Analysis: Proteomic approaches to identify the complete set of proteins that interact with Rh2 would provide insights into its signaling network and regulation.

  • In Vivo Imaging: Developing methods to visualize Rh2 activation in living flies would help understand its real-time function in visual processing.

These research directions would contribute to a more comprehensive understanding of Rh2 biology and potentially lead to biotechnological applications.

How might understanding Rh2 function contribute to broader photoreceptor biology?

Insights from Rh2 research have significant implications for broader photoreceptor biology:

  • Developmental Paradigms: The binary rhodopsin switch controlled by Hth in ocelli provides a model system for understanding how photoreceptor cell fate decisions are regulated during development .

  • Spectral Tuning Mechanisms: Understanding how Rh2's structure determines its violet sensitivity could reveal general principles of spectral tuning applicable across opsin families.

  • Transcriptional Networks: The shared regulatory elements between Rh2, ninaE, and ninaC highlight common mechanisms governing photoreceptor-specific gene expression .

  • Visual System Evolution: Comparing Rh2 with other opsins provides insights into how diverse visual systems evolved across species.

  • Disease Models: As rhodopsin mutations are implicated in human retinal diseases, understanding Rh2 regulation and function could provide comparative insights relevant to human health.

The unique properties and regulatory mechanisms of Rh2 thus serve as a valuable model system for understanding fundamental principles of photoreceptor biology across species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.