Recombinant Drosophila melanogaster Opsin Rh5 (Rh5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage state, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
Rh5; CG5279; Opsin Rh5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Rh5
Target Protein Sequence
MHINGPSGPQAYVNDSLGDGSVFPMGHGYPAEYQHMVHAHWRGFREAPIYYHAGFYIAFI VLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDLFMCTNMPHYLINATVGYIVGG DLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPIDGRLSYGQIVLLILFTWLWATPF SVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFT HVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALI GCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELERRLPWLGIREKHATSG TSGGQESVASVSGDTLALSVQN
Uniprot No.

Target Background

Function
Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Gene References Into Functions
  1. Rh5 and Rh6 were required in trpA1-expressing neurons in the brain, ventral nerve cord, and body wall. Because Rh1 contributes to thermal selection in the comfortable range during the early to mid-third-instar stage, fine thermal discrimination depends on multiple rhodopsins. PMID: 27705783
  2. during metamorphosis, all Rh6 photoreceptors die, whereas the Rh5 photoreceptors switch fate by turning off Rh5 and then turning on Rh6 expression PMID: 18594514
Database Links

KEGG: dme:Dmel_CG5279

STRING: 7227.FBpp0079875

UniGene: Dm.409

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed specifically in the retina. Each Drosophila eye is composed of 800 facets or ommatidia. Each ommatidium contains 8 photoreceptor cells (R1-R8), the R1 to R6 cells are outer cells, while R7 and R8 are inner cells. Rh5 is expressed only in the R8

Q&A

Basic Research Questions

  • What is Drosophila melanogaster Opsin Rh5 and what is its significance in vision research?

    Rh5 is a functional opsin (rhodopsin) expressed in a subset of R8 photoreceptor cells in the Drosophila compound eye. It encodes a biologically active visual pigment that plays a crucial role in Drosophila color vision . The Rh5 gene product is 382 amino acids long with a predicted molecular weight of 43 kD and can be phosphorylated on serine and threonine residues in its C-terminal region .

    Rh5 serves as an important model for studying photoreceptor subtype specification and color vision mechanisms. Its functional activity has been demonstrated through electroretinogram analysis, where Rh5 cDNA expressed under the ninaE promoter can restore light response in ninaE mutants . Research on Rh5 has provided significant insights into the molecular mechanisms of photoreceptor development, opsin regulation, and color discrimination in a genetically tractable model organism.

  • Where and when is Rh5 expressed during Drosophila development?

    Rh5 expression follows a precise spatiotemporal pattern in Drosophila:

    • Developmental timing: Rh5 begins expression in larval photoreceptors at embryonic stages 16-17, and expression continues throughout larval stages .

    • Adult expression: In the adult compound eye, Rh5 is expressed in approximately 29% of R8 photoreceptor cells . These are specifically the R8 cells that lie beneath R7 cells expressing Rh3 (forming what are called "pale" ommatidia) .

    • Cellular specificity: Rh5 is never expressed in R8 cells beneath Rh4-expressing R7 cells (in "yellow" ommatidia) . This demonstrates a precise pairing of opsin expression between these two photoreceptor cell types.

    • Larval expression: In the larval visual system, Rh5 is expressed in 3-4 of the larval photoreceptors, while the remaining photoreceptors express Rh6 .

    This precise pattern of expression is critical for color discrimination and is regulated by complex cell-cell signaling mechanisms.

  • How is Rh5 expression regulated in photoreceptor cells?

    Rh5 expression is regulated through several interrelated mechanisms:

    • Coordination with R7 cells: Rh5 expression in R8 cells is strictly coordinated with Rh3 expression in the overlying R7 cells of individual ommatidia . This coordination requires specific developmental signals between R7 and R8 cells.

    • Repression by Rh6: Rh6 generates a feedback signal that represses Rh5 transcription in yR8 photoreceptors . In rh6 mutants, almost all R8s (95%) express Rh5 by 14 days of age, and rh5 mRNA more than doubles over normal levels .

    • Light-dependent regulation: In dark-reared flies, approximately 12% of Rh6-expressing yR8s also express low levels of Rh5, with this de-repression occurring predominantly in the dorsal retina . This suggests that preventing activation of Rh6 by light can evoke Rh5 expression.

    • Signaling cascade: The repression of Rh5 by Rh6 involves components of the phototransduction cascade, including Gαq and PLC . In Gαq1 hypomorphic mutants, Rh5 becomes de-repressed in yR8 cells as flies age, similar to the phenotype observed in rh6 mutants.

    This complex regulatory network ensures the precise patterning of opsin expression required for Drosophila color vision.

Advanced Research Questions

  • What is the role of the transcription factor Dve in regulating Rh5 expression?

    The transcription factor Defective proventriculus (Dve) plays a critical role in the regulation of Rh5 expression:

    Genetic Background% R8 cells expressing Rh5Rhodopsin Coupling Patterns
    Wild-type29%Precise Rh3/Rh5 and Rh4/Rh6 pairing
    dve1 mutantSimilar to wild-typeAbnormal coupling; 23.1% Rh3/Rh6 vs 0.3% in controls
    R1 cell-specific dve mutant0%Only default (Rh3/Rh6) or yellow-type (Rh4/Rh6) coupling
    sev mutant (no R7 cells)~3%Most R8 cells express Rh6 as default
    sev dve14 double mutantSignificantly increasedShows Dve regulates Rh5 independently of R7

    Research has revealed that:

    • Cell-specific requirements: Dve activity specifically in the R1 photoreceptor is crucial for transmission of the instructive signal that induces Rh5 expression in R8 cells . In R1-specific dve mutant ommatidia, Rh5 is never induced, showing that Dve in R1 is critically required for this process.

    • Signaling pathway: A proposed model suggests that Rh5 expression in R8 is repressed by the Hippo signaling pathway (Wts/Melt) through an unknown signal "X" . In pale-type ommatidia, Rh3-expressing R7 sends a signal to adjacent R1, where activated Dve (Dve*) represses signal "X" and induces Rh5 expression through a relief of repression mechanism.

    • Repressive activities: Dve activities in R7 and R6 photoreceptors repress the activation of Dve in R1, leading to a default state of Rh6 expression in R8 . When dve mutations occur in R6 or R7, atypical Rh4/Rh5 coupling is frequently observed.

    This intricate spatial regulation of Dve activity across different photoreceptor subtypes is essential for establishing the correct pattern of opsin expression required for Drosophila color vision.

  • What experimental approaches are most effective for studying recombinant Rh5 expression and function?

    Several complementary methodological approaches have proven effective for studying Rh5:

    • Genetic mosaic analysis: The MARCM (Mosaic Analysis with a Repressible Cell Marker) system has been successfully employed to induce dve mutations in specific cell types (R1, R6, R7) and analyze the effects on Rh5 expression . This approach allows researchers to assess cell-autonomous and non-cell-autonomous effects on Rh5 regulation.

    • Reporter gene assays: The rh5>GFP reporter containing a -690 to +50 rh5 promoter fragment has been used to analyze the transcriptional regulation of rh5 . This approach helped demonstrate that Rh6 generates a feedback signal that acts to repress transcription from the rh5 promoter.

    • Expression analysis in dissociated ommatidia: Immunostaining of dissociated ommatidia with antibodies against Rh5 and Rh6 allows for quantitative assessment of opsin expression patterns . This technique was used to identify several mutants with abnormal percentages of Rh5-expressing R8 cells, including a69 with the lowest percentage (9%).

    • In situ hybridization: This technique has been used to detect rh5 mRNA expression in eye imaginal discs and to demonstrate de-repression of rh5 in rh6 mutants .

    • Quantitative RT-PCR: This method provides quantitative measurements of changes in rh5 mRNA levels under different genetic and environmental conditions .

    • Dark/light rearing experiments: Manipulating light exposure has revealed the light-dependent nature of Rh5 regulation, with dark-reared flies showing partial de-repression of Rh5 in yR8 photoreceptors that normally express only Rh6 .

    For recombinant Rh5 production, although not directly described in the search results for Drosophila Rh5, the Drosophila S2 cell expression system has been successfully used for other complex proteins and could potentially be adapted for Rh5 expression with appropriate modifications.

  • How do mutations affecting Rh5 expression impact photoreceptor coupling and color vision?

    Mutations affecting Rh5 expression reveal important insights about photoreceptor coupling and color vision mechanisms:

    • a69 mutant: This mutant, which has the lowest percentage of Rh5-expressing R8 cells (9%), shows dramatic mispairing between Rh3-expressing R7 cells and Rh6-expressing R8 cells . This indicates that a69 specifically disrupts the communication between R7 and R8 cells that coordinates opsin expression.

    • sevenless (sev) mutant: In these flies, which lack R7 photoreceptor cells, the expression of Rh5 in R8 cells is dramatically reduced (~3%), with most R8 cells expressing Rh6 as the default state . This provides evidence for a specific developmental signal from R7 to R8 that is responsible for the paired expression of opsin genes.

    • dve mutants: In dve1 mutant eyes, the ratio of Rh5/Rh6 in the R8 layer remains similar to controls, but their coupling to R7 Rhodopsins is abnormal, with Rh3/Rh6 coupling observed at 23.1% compared to just 0.3% in controls . This demonstrates that Dve is crucial for proper opsin coupling between R7 and R8 cells.

    • rh6 mutants: In these mutants, rh5 expression is de-repressed in most R8 cells as flies age, with nearly all (95%) R8s expressing Rh5 by day 14 . This reveals that Rh6 normally generates a feedback signal that represses rh5 transcription.

    • Cell-specific dve mutants: Analysis of R1, R6, and R7-specific dve mutants has demonstrated that Dve activity in R1 is required for transmission of the instructive Rh5-inducing signal, while Dve activities in R6 and R7 block this signal .

    These findings collectively demonstrate that proper Rh5 expression and photoreceptor coupling depend on complex cell-cell signaling mechanisms and are essential for normal color vision in Drosophila.

  • What is the relationship between Rh5 and the phototransduction cascade?

    Research has revealed important connections between Rh5 and the phototransduction cascade:

    • Feedback regulation: The repression of rh5 by Rh6 requires components of the phototransduction cascade . In Gαq1 hypomorphic mutants, Rh5 becomes de-repressed in yR8 cells as flies age, similar to the phenotype observed in rh6 mutants.

    • Signaling components: The feedback mechanism involves activated Rh6 converting the Gαq subunit of a heterotrimeric G-protein to a GTP-bound form, which then dissociates from the Gβγ dimer and activates Phospholipase C (PLC), encoded by the norpA gene . This cascade ultimately leads to repression of rh5 transcription.

    • Light-dependent regulation: The dependence on the phototransduction cascade explains why preventing activation of Rh6 by light (in dark-reared flies) can lead to partial de-repression of Rh5 in yR8 cells .

    • Functional activity: Rh5 itself encodes a functional opsin that can activate the phototransduction cascade, as demonstrated by its ability to restore light response in ninaE mutants when expressed under the ninaE promoter .

    • Spectral sensitivity: While the search results don't specify the exact spectral sensitivity of Rh5, its expression pattern suggests it is likely involved in detecting a specific wavelength range, contributing to color discrimination in Drosophila.

    This interplay between Rh5, Rh6, and the phototransduction cascade highlights the sophisticated mechanisms that regulate opsin expression and function in the Drosophila visual system.

  • How can recombinant Drosophila Rh5 be optimally expressed and purified for structural and functional studies?

    While the search results don't provide specific protocols for recombinant Drosophila Rh5 expression, several approaches can be inferred:

    • Expression systems: The Drosophila S2 cell system has been successfully used for expression of other complex proteins . This system would be particularly suitable for Rh5 as it provides the correct post-translational modifications and protein folding environment for Drosophila proteins.

    • Affinity tags: Addition of affinity tags such as C-tag (EPEA) or other common tags (His, FLAG, Strep) would facilitate purification. These tags should be added in a position that doesn't interfere with protein folding or function, typically at the C-terminus.

    • Protein stability: Membrane proteins like opsins often require stabilization during expression and purification. This can be achieved through:

      • Addition of stabilizing mutations

      • Use of appropriate detergents for solubilization

      • Maintaining low temperature during purification

      • Including specific lipids that stabilize the native conformation

    • Purification strategy: A multi-step purification approach similar to that used for other membrane proteins would likely be effective:

      1. Cell lysis in the presence of appropriate detergents

      2. Affinity chromatography using the engineered tag

      3. Size exclusion chromatography for further purification

      4. Optional: Ion exchange chromatography for additional purity

    • Quality control: Methods to assess the quality of purified recombinant Rh5 should include:

      • SDS-PAGE for purity assessment

      • Western blotting for identity confirmation

      • Spectroscopic analysis to confirm proper folding and chromophore binding

      • Functional assays such as G-protein activation tests

    Successful expression and purification of recombinant Rh5 would enable detailed structural studies and in vitro functional assays that could provide important insights into the mechanisms of opsin function and regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.