Recombinant Drosophila melanogaster ORM1-like protein (ORMDL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Drosophila melanogaster ORM1-like protein (ORMDL)

Recombinant Drosophila melanogaster ORM1-like protein (ORMDL) is a synthetically produced version of the ORMDL protein found in fruit flies (Drosophila melanogaster) . ORMDL proteins are a conserved family of endoplasmic reticulum (ER) transmembrane proteins present across various species, including humans, yeast, and Drosophila . These proteins play a crucial role in maintaining ER homeostasis and regulating sphingolipid biosynthesis .

Characteristics and Features

  • Origin: Derived from Drosophila melanogaster, making it valuable for studying gene function in a well-established genetic model organism .

  • Production: Produced using an in vitro E. coli expression system, ensuring high purity .

  • Expression: ORMDL is expressed throughout embryonic and larval stages, particularly in ectodermally derived tissues . In Drosophila, the dFmr1 protein, similar to mammalian gene products, is expressed from embryonic stages to adulthood and is abundant in the nervous system .

  • Function: ORMDL proteins are involved in ER homeostasis, stress response, and lipid metabolism . They also interact with autophagy proteins, influencing autophagic flux .

  • Homology: Human ORMDL1 shares significant identity (83-84%) with ORMDL2 and ORMDL3, suggesting a gene duplication event. There is also substantial identity between ORMDL proteins in humans and other vertebrates .

Role in Cellular Processes

ORMDL proteins significantly impact various cellular processes:

  • ER Homeostasis: ORMDL proteins are key in maintaining the stability and function of the endoplasmic reticulum. Disruption of ORMDL function leads to ER stress and impaired unfolded protein response (UPR) .

  • Sphingolipid Biosynthesis: These proteins regulate the production of sphingolipids, which are essential components of cell membranes and signaling molecules .

  • Autophagy: ORMDL interacts directly with autophagy proteins and influences autophagic flux, which is vital for clearing damaged or unnecessary cellular components .

  • Stress Response: ORMDL proteins affect cellular stress responses, including the UPR, cell wall stress response, and heat shock response .

  • Genome Stability: In Drosophila, dFmr1, which interacts with ORMDL, is involved in the piRNA pathway and DNA damage response, linking it to genome stability .

Research Findings

Research has provided insights into the functions and impacts of ORMDL proteins:

  • Intestinal Inflammation: Studies on mice deficient in ORMDL proteins show reduced body weight and impaired intestinal function. Loss of ORMDL proteins leads to dilation of the ER and impaired autophagic flux. Additionally, the unfolded protein response and Cxcl1 expression are insufficiently induced in intestinal organoids from ORMDL-deficient animals .

  • Single-Cell RNA Sequencing (scRNAseq) Analysis: ScRNAseq analysis of small intestine tissue revealed compensatory induction of antimicrobial peptides in non-Paneth cells and downregulation of apoptosis-regulating genes in ORMDL-deficient mice. The study also observed an expansion of myeloid and plasma cells, accompanied by dysbiosis of the stool microbiome .

  • Fragile-X Syndrome (FXS) Studies: Drosophila melanogaster is used as a model to understand the physiopathological mechanisms underlying Fragile-X syndrome. The Drosophila dFmr1 protein, which interacts with ORMDL, is crucial in studying molecular pathways defective in FXS .

  • Yeast Studies: Studies on yeast (Saccharomyces cerevisiae) homologs of ORMDL show that double knockout mutants exhibit decreased growth rate and increased sensitivity to ER stress-inducing agents. These mutants can be rescued by human ORMDL homologs, highlighting the conserved function of these proteins .

  • Membrane Biogenesis: ORMDL proteins play a central role in membrane biogenesis at the ER, coordinating lipid and protein synthesis. Disruptions in ORMDL function reveal interrelationships between lipid homeostatic mechanisms and protein quality control .

  • Interaction with Argonaute Proteins: dFmr1 interacts with Argonaute proteins, which are key components of RNA-mediated silencing pathways. This interaction is crucial in the gonads and nervous system, affecting processes such as germline stem cell differentiation and regulation of transposable elements .

Tables of Data

Due to the limitations of accessing specific data tables directly, representative information is presented based on available research.

Table 1: Effects of ORMDL Deficiency in Mice

ParameterObservation
Body WeightReduced, dependent on the number of ORMDL knockouts
Intestinal MorphologyMassive dilation/ballooning of the ER, reduced number of Paneth and goblet cells
AutophagyImpaired autophagic flux
Unfolded Protein Response (UPR)Insufficient induction in intestinal organoids treated with tunicamycin
Immune CellsExpansion of myeloid and plasma cells
MicrobiomeDysbiosis of the stool microbiome (β-diversity, Bray-Curtis dissimilarity)

Table 2: Interactions of dFmr1 in Drosophila

ProteinInteractionFunction/Role
Ago1Interacts with bantam microRNA in the ovary Regulates the fate of germline stem cells, implicated in terminal dendrites elongation, required for correct function at the neuromuscular junction (NMJ)
PiwiPresent in the same complex in ovarian extracts Acts together in piRNA-mediated transcriptional silencing on transposable elements in somatic and germline tissues of the ovary
Vasa, Cup, and Hsp83Interacts in the polar granules of the embryo Component of the polar granules, involved in translational regulation
Argonaute proteinsInteracts with Ago2 and components of the RISC in S2 Drosophila cells, interacts with multiple Ago proteins Involved in RNA-mediated silencing pathways, affects germline stem cell differentiation, regulates transposable elements, and influences dendrite elongation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ORMDL; CG14577; ORM1-like protein; dORMDL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
ORMDL
Target Protein Sequence
MTSIAGGHGEANPNSSWLSARGFWLAYLLGLLSVHLLFLSVPFVSIPWAWTATNLLHNAA HLYFLHVIKGAPWLSTENDPSRRWTHWEQIDDGVQMTTTRKFLTAVPIVLFLLTCLYTRN NTEHFIPNFISLVVVTLPKLPQFHGVRLFNINKY
Uniprot No.

Target Background

Function
Negative regulator of sphingolipid synthesis.
Gene References Into Functions
  • ORMDL deregulation increases stress responses and modulates repair pathways in Drosophila airways. PMID: 25979522
Database Links

KEGG: dme:Dmel_CG14577

STRING: 7227.FBpp0078077

UniGene: Dm.15066

Protein Families
ORM family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously and homogeneously expressed in the syncytial blastoderm and during the cellularization stage. In stages 11-12, it is expressed in the germ-band layer In later stages (stage 14), it is mainly detected in the ectodermal tissues. In imaginal dis

Q&A

What is the Drosophila melanogaster ORMDL protein and how does it compare to its homologs in other species?

ORMDL proteins constitute a novel, evolutionarily conserved gene family found across diverse organisms from yeast to humans. In Drosophila melanogaster, ORMDL (also annotated as CG14577 or DmelCG14577) is part of this conserved family of transmembrane proteins localized to the endoplasmic reticulum (ER). The Drosophila ORMDL protein is 154 amino acids in length, one amino acid longer at the N-terminus than human ORMDL proteins, and shares 48-50% sequence identity with its human counterparts .

The evolutionary conservation of this protein family is illustrated in the table below:

OrganismGene nameProtein length (aa)Structural domainsExpression patternSubcellular localization
H. sapiensORMDL11534 TMUbiquitous in adult and fetal tissuesEndoplasmic reticulum
H. sapiensORMDL21533 TMUbiquitous in adult and fetal tissuesEndoplasmic reticulum
H. sapiensORMDL31534 TMUbiquitous in adult and fetal tissuesEndoplasmic reticulum
D. melanogasterORMDL1543 TMUbiquitous at early embryonic stages and in ectodermal derived tissues at later stagesNot tested
S. cerevisiaeORM12224 TMNot testedNot tested
S. cerevisiaeORM22164 TMNot testedNot tested

This conservation across species suggests crucial cellular functions for ORMDL proteins, making Drosophila an excellent model system for studying their biological roles .

How is the genomic structure of Drosophila ORMDL organized?

The genomic structure of the Drosophila ORMDL gene follows a conserved pattern observed across eukaryotic ORMDL genes. Unlike yeast homologs which are encoded by a single continuous ORF, the Drosophila ORMDL gene consists of three coding exons separated by introns, with conserved exon-intron boundaries. This genomic organization is remarkably preserved across diverse species including humans and Arabidopsis .

To study this gene structure experimentally:

  • Design PCR primers flanking the exon-intron boundaries

  • Amplify genomic DNA and cDNA in parallel

  • Compare fragment sizes to confirm intron positions

  • Sequence the products to verify splice junction sequences

This three-exon structure is functionally significant as it allows for potential alternative splicing regulation, which might generate protein isoforms with distinct functional properties in different developmental contexts .

What expression patterns does ORMDL show during Drosophila development?

The Drosophila ORMDL homolog exhibits a dynamic expression pattern throughout development. It is expressed ubiquitously during early embryonic stages and becomes more prominently expressed in ectodermally-derived tissues at later developmental stages . This pattern suggests potential roles in tissue differentiation and morphogenesis.

Methodologically, this expression pattern can be analyzed through:

  • RNA in situ hybridization with ORMDL-specific probes across developmental stages

  • Quantitative RT-PCR from tissues collected at different developmental timepoints

  • Reporter gene constructs using the ORMDL promoter region to drive expression of fluorescent proteins

  • Immunohistochemistry using anti-ORMDL antibodies, such as the commercially available rabbit polyclonal antibodies against Drosophila ORMDL

The temporal and spatial regulation of ORMDL expression provides important clues about its biological functions during development and tissue specification.

What are the optimal expression systems for producing recombinant Drosophila ORMDL protein?

For recombinant expression of Drosophila ORMDL protein, several systems can be employed, each with distinct advantages depending on your experimental goals:

Bacterial expression systems (E. coli):

  • Advantages: High yield, cost-effective, rapid expression

  • Methodology: Clone the Drosophila ORMDL CG14577 cDNA into a bacterial expression vector (pET series) with an appropriate tag (His6, GST)

  • Considerations: As a transmembrane protein, ORMDL may require specialized strains (C41/C43) or solubilization strategies

Insect cell expression systems:

  • Advantages: Native-like post-translational modifications, proper membrane protein folding

  • Methodology: Clone ORMDL cDNA into baculovirus transfer vectors (pFastBac) for expression in Sf9 or High Five cells

  • Considerations: Higher cost but better protein quality for a transmembrane ER protein like ORMDL

Drosophila S2 cell expression:

  • Advantages: Homologous system ensuring proper folding and post-translational modifications

  • Methodology: Clone ORMDL into pMT/V5-His or similar vectors under metallothionein promoter

  • Considerations: Lower yields but physiologically relevant modifications

For purification, consider detergent-based extraction methods (CHAPS, DDM) to maintain native conformation of this transmembrane protein. The choice of expression system should align with your downstream applications, whether structural studies, functional assays, or antibody production .

What methods are most effective for studying ORMDL localization and protein-protein interactions in Drosophila cells?

To study ORMDL localization and interactions in Drosophila cells, several complementary approaches can be employed:

Subcellular localization:

  • Immunofluorescence microscopy using specific anti-ORMDL antibodies

  • Expression of fluorescently-tagged ORMDL (GFP/RFP-ORMDL) in Drosophila S2 cells or transgenic flies

  • Co-localization with ER markers (e.g., KDEL-tagged proteins)

  • Subcellular fractionation followed by Western blotting

Protein-protein interactions:

  • Co-immunoprecipitation using anti-ORMDL antibodies followed by mass spectrometry

  • Yeast two-hybrid screening (similar to the approach used for RBP1 protein interactions in search result )

  • Proximity labeling methods (BioID, APEX) with ORMDL as the bait

  • FRET/BRET assays for direct interaction studies in live cells

For membrane proteins like ORMDL, crosslinking approaches prior to immunoprecipitation often improve detection of transient interactions. Based on studies in yeast, focus on potential interactions with proteins involved in ER stress response and lipid metabolism pathways .

A significant methodological consideration is the use of appropriate antibodies. Several anti-ORMDL antibodies are available, including rabbit polyclonal antibodies against Drosophila ORMDL suitable for Western blot and ELISA applications .

How can CRISPR-Cas9 genome editing be optimized for studying ORMDL function in Drosophila models?

CRISPR-Cas9 genome editing provides powerful approaches for studying ORMDL function in Drosophila:

Knockout strategy:

  • Design sgRNAs targeting exon 1 of the ORMDL gene (CG14577) using tools like CHOPCHOP

  • Clone sgRNAs into pU6-BbsI-chiRNA vector

  • For germline editing, inject into nos-Cas9 embryos

  • Screen potential knockouts using PCR, T7 endonuclease assay, and sequencing

  • Establish homozygous stocks for phenotypic analysis

Knock-in approaches for tagging or mutagenesis:

  • Design homology-directed repair (HDR) template with 1kb homology arms

  • For C-terminal tagging, incorporate GFP or epitope tags (e.g., FLAG, HA)

  • For structure-function studies, introduce mutations in predicted transmembrane domains

  • Co-inject sgRNA, Cas9, and HDR template

  • Screen by fluorescence (for GFP tags) or PCR for smaller tags

Phenotypic analysis:

  • Assess viability and developmental timing

  • Examine ER morphology using fluorescent markers

  • Analyze ER stress response using established reporter systems

  • Test for sensitivity to ER stressors like tunicamycin and DTT (as observed in yeast ORMDL mutants)

When designing knockout strategies, consider the small size of the ORMDL gene and its conserved structure of three coding exons to ensure complete functional disruption .

How do Drosophila ORMDL proteins participate in the ER stress response pathway?

Based on studies in yeast and other systems, Drosophila ORMDL likely plays important roles in ER stress response pathways:

Functional relationship with ER stress:

  • Yeast ORM proteins demonstrate links to the unfolded protein response (UPR)

  • Double knockout of yeast ORM1/ORM2 homologs results in increased sensitivity to ER stressors like tunicamycin and DTT

  • Human ORMDL3 has been implicated in ER stress response mechanisms

Methodological approaches to investigate this relationship:

  • Expose ORMDL-depleted Drosophila S2 cells to ER stressors (tunicamycin, thapsigargin, DTT)

  • Monitor UPR activation markers in control versus ORMDL-deficient cells:

    • Xbp1 splicing assay (IRE1 pathway)

    • ATF4 expression analysis (PERK pathway)

    • Chaperone induction (BiP/GRP78 levels)

  • Rescue experiments using recombinant wild-type or mutant ORMDL proteins

  • Analyze genetic interactions between ORMDL and core UPR components through double mutant analysis

The IRE1-XBP1 pathway may be particularly relevant as it represents the most evolutionarily conserved branch of the UPR and is active in both yeast and Drosophila . Analyzing how ORMDL affects IRE1-mediated Xbp1 splicing could provide mechanistic insights into its function in ER homeostasis.

What techniques can resolve contradictory findings about ORMDL function in different experimental systems?

Researchers often encounter conflicting data when studying conserved proteins like ORMDL across different experimental systems. To resolve such contradictions:

Methodological approaches:

  • Parallel system analysis:

    • Express Drosophila ORMDL in yeast orm1Δ/orm2Δ mutants to test functional conservation

    • Compare phenotypes of ORMDL knockdown in Drosophila S2 cells, mammalian cells, and yeast

    • Use the same assay platforms across different systems to minimize technical variability

  • Domain swap experiments:

    • Create chimeric proteins with domains from Drosophila and human ORMDLs

    • Test which domains are responsible for species-specific functions

    • Identify conserved vs. divergent functional motifs

  • Temporal and tissue-specific manipulation:

    • Generate conditional knockout/knockdown models in Drosophila

    • Compare acute vs. chronic loss of ORMDL function

    • Assess tissue-specific effects, particularly in ectodermally-derived tissues where ORMDL is highly expressed

  • Quantitative proteomics and interactome mapping:

    • Compare ORMDL-interacting proteins across systems

    • Identify conserved and species-specific interaction networks

  • Evolutionary context analysis:

    • Include multiple species (yeast, Drosophila, mammals) in comparative studies

    • Consider duplication events (humans have three ORMDL genes, Drosophila has one)

By systematically comparing ORMDL function across systems while controlling for experimental variables, researchers can distinguish between conserved core functions and species-specific adaptations.

How can evolutionary analysis of ORMDL proteins inform functional studies in Drosophila?

Evolutionary analysis provides valuable context for functional studies of Drosophila ORMDL:

Comparative genomic approaches:

  • Construct phylogenetic trees of ORMDL family proteins across species

    • The family includes proteins from yeast, microsporidia, plants, Drosophila, urochordates, and vertebrates

    • Vertebrates possess three ORMDL genes (ORMDL1-3), while Drosophila has a single copy

  • Identify selection signatures in ORMDL sequences

    • Calculate dN/dS ratios across lineages

    • Identify highly conserved residues as functionally critical targets for mutagenesis

  • Compare synteny and genomic organization

    • The three-exon structure is conserved from Drosophila to humans

    • Analyze conserved regulatory elements in promoter regions

Functional implications:

  • Drosophila ORMDL represents an ancestral state before the gene duplications in vertebrates

  • Single-copy status in Drosophila simplifies loss-of-function studies (avoiding redundancy)

  • Conservation of transmembrane domains suggests structural constraints on protein function

  • Divergence in N- and C-terminal regions may represent species-specific adaptations

Methodological approaches:

  • Complement yeast orm1Δ/orm2Δ mutants with Drosophila ORMDL to test functional conservation

  • Express human ORMDL1-3 in Drosophila ORMDL mutants to test functional equivalence

  • Create chimeric proteins to map functional domains

  • Test for conservation of interaction partners across species

These evolutionary insights can guide the design of targeted experiments to dissect the core functions of ORMDL proteins that have been maintained throughout eukaryotic evolution .

What bioinformatic approaches are most useful for analyzing ORMDL sequence and structural features?

For comprehensive bioinformatic analysis of Drosophila ORMDL proteins, several complementary approaches are recommended:

Sequence analysis:

  • Multiple sequence alignment with CLUSTALW to identify conserved residues across species

    • Include sequences from yeast, plants, Drosophila, and vertebrates

    • Focus on the 116 out of 153 amino acid residues conserved across human ORMDL paralogs

  • Motif identification and functional domain analysis

    • Analyze the four putative transmembrane domains using TMHMM, Phobius

    • Identify potential post-translational modification sites (NetPhos, NetOGlyc)

Structural prediction and modeling:

  • Generate structural models using:

    • AlphaFold2 for ab initio structure prediction

    • Homology modeling based on structurally characterized membrane proteins

    • Molecular dynamics simulations to assess conformational stability

  • Analyze membrane topology and orientation:

    • Predict ER lumenal vs. cytoplasmic domains

    • Map conserved residues onto structural models

    • Model interactions with lipid bilayers

Functional inference:

  • Predict functional sites using ConSurf (evolutionary conservation)

  • Analyze potential protein-protein interaction interfaces

  • Compare with known structural features of ER transmembrane proteins

Visualization and integration:

  • Generate conservation heat maps projected onto structural models

  • Create hydrophobicity plots to confirm transmembrane domains

  • Integrate data from multiple prediction algorithms using consensus approaches

These bioinformatic approaches provide testable hypotheses about structure-function relationships in ORMDL proteins that can guide experimental design for mutagenesis and functional studies .

What genetic approaches can be used to study ORMDL function in the context of Drosophila development?

To investigate ORMDL function in Drosophila development, several genetic approaches can be employed:

Forward genetic screens:

  • EMS mutagenesis combined with phenotypic selection

  • Modifier screens using sensitized backgrounds:

    • Screen for enhancers/suppressors of known ER stress phenotypes

    • Use GAL4-UAS system to express dominant-negative ORMDL forms

Reverse genetic approaches:

  • CRISPR-Cas9 gene editing to generate:

    • Complete knockouts

    • Domain-specific mutations

    • Fluorescent protein fusions at endogenous loci

  • Transgenic RNAi using:

    • Ubiquitous drivers (Actin-GAL4, Tubulin-GAL4)

    • Tissue-specific drivers focused on ectodermal tissues where ORMDL expression is highest

    • Inducible systems (temperature-sensitive GAL80ts) for temporal control

Tissue-specific analysis:

  • Clonal analysis using FLP/FRT system to generate ORMDL mutant clones in specific tissues

  • Twin-spot analysis to compare mutant and wild-type cells within the same tissue

  • GAL4-UAS system with tissue-specific drivers to manipulate ORMDL expression

Interaction studies:

  • Genetic interaction tests with components of:

    • ER stress pathways (IRE1, PERK)

    • Lipid metabolism pathways

    • Secretory pathway components

  • Enhancer/suppressor screens:

    • Dominantly modify an ORMDL overexpression phenotype

    • Identify genes functioning in the same pathways

For developmental studies, combine these genetic approaches with careful developmental staging and tissue-specific analysis, particularly focusing on ectodermal tissues where ORMDL shows highest expression during later developmental stages .

How can recombination-based mapping approaches be optimized for studying ORMDL genetic interactions in Drosophila?

Recombination-based mapping approaches provide powerful tools for studying ORMDL genetic interactions in Drosophila:

Fine-scale recombination mapping:

  • Utilize high-throughput sequencing to map recombination events with precision

    • Design crosses similar to those used in Singh et al. to generate recombinant chromosomes

    • Use SNP markers to track recombination events at high resolution

    • Employ target-enrichment strategies to focus sequencing on regions of interest

  • Develop recombinant inbred line (RIL) panels:

    • Create RILs between distinct genetic backgrounds carrying ORMDL variants

    • Allow interbreeding for 12-13 generations to maximize recombination

    • Genotype resulting lines using whole-genome sequencing

    • Phenotype lines for ORMDL-related traits

Quantitative trait locus (QTL) mapping:

  • Identify genetic modifiers of ORMDL function:

    • Cross ORMDL mutant flies to diverse genetic backgrounds

    • Phenotype recombinant progeny for ER stress sensitivity

    • Map QTLs that enhance or suppress ORMDL phenotypes

    • Calculate LOD scores to identify significant interactions

  • Investigate epistatic interactions:

    • Test for interaction LOD scores between ORMDL locus and other genomic windows

    • Simulate different interaction models to interpret results

    • Validate predicted interactions through targeted genetic approaches

Experimental considerations:

  • Control for genetic background effects:

    • Use isogenic stocks to minimize confounding variables

    • Include appropriate controls in all crosses

    • Perform reciprocal crosses to account for maternal effects

  • Optimize marker density:

    • Position SNP markers at approximately 5kb intervals for fine mapping

    • Focus on regions showing significant recombination rate variation

    • Consider higher density in candidate interaction regions

  • Validate through complementary approaches:

    • Confirm interactions using targeted genetic manipulations

    • Employ biochemical approaches to test direct interactions

    • Use cell-based assays to assess functional relationships

These recombination-based mapping approaches provide powerful tools for dissecting the genetic architecture of ORMDL function and identifying genes that interact with ORMDL in Drosophila .

What are the critical quality control parameters for recombinant Drosophila ORMDL protein production?

To ensure high-quality recombinant Drosophila ORMDL protein for experimental use, several critical quality control parameters must be monitored:

Expression verification:

  • Western blot analysis using specific anti-ORMDL antibodies

    • Confirm expected molecular weight (~17-18 kDa)

    • Check for degradation products or aggregates

  • Mass spectrometry validation of protein identity

    • Peptide mass fingerprinting

    • Sequence coverage analysis

Purity assessment:

  • SDS-PAGE with Coomassie/silver staining (aim for >90% purity)

  • Size exclusion chromatography to detect aggregates

  • Analytical ultracentrifugation to assess homogeneity

Functional verification:

  • Proper membrane integration and folding:

    • Circular dichroism to verify secondary structure (expected alpha-helical content)

    • Thermal stability assays to assess proper folding

  • Lipid binding assays (if applicable)

  • Interaction with known binding partners

Stability monitoring:

  • Time-course stability analysis at different temperatures

  • Freeze-thaw stability assessment

  • Buffer optimization to maximize stability of this membrane protein

Given ORMDL's transmembrane nature, special consideration should be given to the detergent or lipid environment used for purification and storage. A critical step is verifying that the recombinant protein retains its native fold and functionality, which can be assessed by its ability to complement ORMDL-deficient cells or yeast orm mutants .

How can antibody-based detection methods for Drosophila ORMDL be optimized for different experimental applications?

Optimizing antibody-based detection of Drosophila ORMDL requires tailored approaches for different experimental applications:

Western blot optimization:

  • Sample preparation considerations:

    • Include appropriate detergents (CHAPS, DDM) for membrane protein extraction

    • Heat samples at lower temperatures (37°C instead of 95°C) to prevent aggregation

    • Use fresh samples when possible to minimize degradation

  • Antibody selection and validation:

    • Rabbit polyclonal antibodies against Drosophila ORMDL are available for Western blot applications

    • Validate specificity using ORMDL knockout/knockdown controls

    • Optimize primary antibody concentration (typically 1:500-1:5000)

    • Select appropriate secondary antibodies based on detection method

Immunohistochemistry/Immunofluorescence:

  • Fixation optimization:

    • Test multiple fixation methods (4% PFA, methanol, Bouin's)

    • Optimize fixation time to balance epitope preservation and tissue penetration

    • Consider specialized membrane protein fixation protocols

  • Antigen retrieval:

    • Evaluate need for antigen retrieval (citrate buffer, protease treatment)

    • Optimize permeabilization for this transmembrane protein

  • Signal enhancement and background reduction:

    • Use tyramide signal amplification for low abundance detection

    • Employ appropriate blocking reagents to reduce background

    • Include detergents in wash buffers to reduce non-specific binding

ELISA applications:

  • Coating optimization:

    • Determine optimal coating buffer and concentration

    • Consider capturing antibody approach for native conformation

  • Assay development:

    • Establish standard curves using purified recombinant ORMDL

    • Determine detection limits and linear range

    • Validate specificity using competitive inhibition

Flow cytometry:

  • Cell preparation:

    • Optimize fixation and permeabilization for intracellular detection

    • Test different detergents for membrane protein staining

  • Controls:

    • Include isotype controls for rabbit antibodies

    • Use ORMDL-depleted cells as negative controls

For all applications, validation using genetic knockdown/knockout controls is essential, particularly given the conserved nature of ORMDL proteins and potential cross-reactivity issues .

How might high-throughput crossover mapping techniques advance our understanding of ORMDL genomic interactions?

High-throughput crossover mapping techniques represent a cutting-edge approach to understanding ORMDL genomic interactions in Drosophila:

Advanced mapping methodologies:

  • Pool-seq approaches for identifying recombination events:

    • Mix DNA from 100 flies with similar recombinant genotypes

    • Use target-enriched shotgun sequencing to focus on regions of interest

    • Analyze allele frequency transitions to precisely map crossover positions

  • Applications to ORMDL research:

    • Map genetic modifiers of ORMDL phenotypes with high precision

    • Identify regions of the genome that interact genetically with ORMDL

    • Discover recombination hotspots near the ORMDL locus

Fine-scale recombination analysis:

  • Investigate recombination heterogeneity around the ORMDL locus:

    • Recombination rates can vary up to 90-fold at the 5-kb scale in Drosophila

    • Analyze how ORMDL variants might influence local recombination patterns

    • Correlate sequence features with recombination rate variation

  • Methodological implementation:

    • Design crosses between ORMDL variant-carrying strains

    • Use dominant visible markers to select recombinants (similar to the garnet-scalloped approach)

    • Apply next-generation sequencing to identify precise crossover locations

    • Use computational approaches to correlate sequence features with recombination events

Integration with functional genomics:

  • Combine recombination mapping with:

    • RNA-seq to identify expression quantitative trait loci (eQTLs) affecting ORMDL

    • ChIP-seq to map chromatin state around recombination hotspots

    • Hi-C to explore three-dimensional genome organization effects

These high-throughput approaches enable the mapping of genetic interactions at unprecedented resolution, potentially revealing new genetic modifiers of ORMDL function and insights into how ORMDL variants might influence genome stability and recombination patterns .

What can evolutionary comparisons between Drosophila and human ORMDL genes reveal about functional divergence?

Evolutionary comparisons between Drosophila and human ORMDL genes offer valuable insights into functional divergence and conservation:

Genomic architecture differences:

  • Human genome contains three ORMDL paralogs (ORMDL1, ORMDL2, ORMDL3), while Drosophila has a single copy

  • Human ORMDL genes are located on different chromosomes (2q32.2, 12q13.2, 17q21.1)

  • Despite these differences, all maintain a conserved three-exon structure

Protein sequence comparison:

  • Human ORMDL proteins share 80-84% sequence identity with each other

  • Drosophila ORMDL shares 48-50% identity with human homologs

  • 116 out of 153 amino acid residues are conserved across human ORMDL paralogs

Functional implications:

  • Single Drosophila ORMDL likely performs functions distributed among three human paralogs

  • Human ORMDL genes may have undergone subfunctionalization or neofunctionalization

  • ORMDL3 variants are associated with asthma susceptibility in humans , suggesting evolved functions

Methodological approaches to study divergence:

  • Complementation experiments:

    • Express each human ORMDL paralog in Drosophila ORMDL mutants

    • Test ability to rescue phenotypes

    • Identify paralog-specific functions

  • Domain swap experiments:

    • Create chimeric proteins between Drosophila and human ORMDLs

    • Map functional domains and species-specific regions

  • Comparative interactome analysis:

    • Identify binding partners of Drosophila ORMDL and human paralogs

    • Map conserved vs. divergent interaction networks

    • Connect to known disease associations (e.g., ORMDL3-asthma connection)

This evolutionary perspective is particularly valuable for extrapolating findings from Drosophila models to human health, especially regarding ORMDL3's association with asthma risk through genome-wide association studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.