Recombinant Drosophila melanogaster Peptidoglycan-recognition protein LF (PGRP-LF)

Shipped with Ice Packs
In Stock

Description

Introduction

Peptidoglycan-recognition proteins (PGRPs) are a family of pattern recognition receptors (PRRs) involved in the innate immune system of insects and mammals . In Drosophila melanogaster, PGRPs play a crucial role in recognizing peptidoglycans (PGNs), which are components of bacterial cell walls, and initiating immune responses such as the induction of antimicrobial peptides and melanization . Among the Drosophila PGRP family, PGRP-LF is a transmembrane protein known for its specific negative regulation of the immune deficiency (Imd) pathway .

Gene Structure and Expression

Drosophila melanogaster expresses 12 PGRP genes, distributed in 8 chromosomal loci on the 3 major chromosomes . These genes are grouped into two classes based on transcript length: short transcripts (PGRP-SA, SB1, SB2, SC1A, SC1B, SC2, and SD) and long transcripts (PGRP-LA, LB, LC, LD, and LE) . PGRP-LF belongs to the latter group . The long PGRPs exhibit complex transcription patterns with several alternative transcripts .

PGRP-LF mRNA is strongly enriched in ectodermal tissues such as the cuticle, foregut, and hindgut, with lower levels in the fat body and midgut . This expression pattern is unexpected because mesodermal derivatives are the primary immune tissues where bacterial infection triggers Imd pathway activation .

Protein Structure and Function

PGRP-LF is a transmembrane protein that acts as a negative regulator of the Imd pathway in Drosophila . The ectodomain of PGRP-LF consists of two PGRP domains, LFz and LFw . Crystal structure analysis reveals that these domains lack the PGN-docking groove found in other PGRP domains, indicating that PGRP-LF cannot directly interact with PGN .

Surface plasmon resonance (SPR) analysis has demonstrated that the PGRP-LF ectodomain interacts with the PGRP-LCx ectodomain in both the absence and presence of tracheal cytotoxin (TCT) . This interaction suggests a mechanism for Imd downregulation based on competition between PRGP-LCa and PGRP-LF for binding to PGRP-LCx .

Role in Innate Immunity

PGRP-LF functions synergistically with PGRP-LC in producing resistance to Escherichia coli and Bacillus megaterium infections, which have the DAP-type peptidoglycan . PGRP-LE acts both upstream and in parallel with PGRP-LC in the Imd pathway and is required for infection-dependent activation of melanization in Drosophila .

PGRP-LC is an essential component of a signal-transducing receptor complex that binds peptidoglycan PAMPs and initiates the cellular response to this PAMP . Unlike PGRP-SA, which is a small, soluble protein that circulates in the hemolymph and is required for activation of a hemolymph protease cascade, PGRP-LC is a transmembrane protein that acts as a PRR that directly couples pathogen recognition to intracellular signaling .

Interaction with Diap1

PGRP-LF inhibits apoptosis by overexpressing the negative regulator of apoptosis, Diap1, specifically in PGRP-LF expressing cells . Inactivation of PGRP-LF is associated with ectopic expression of Diap1-GFP4. 3 in all lateral epidermal cells (LECs) and other PGRP-LF expressing tissues such as the trachea and hindgut .

Plant Genome Research Program (PGRP)

The Plant Genome Research Program (PGRP) supports genome-scale research that addresses challenging questions of biological, societal, and economic importance . The goals of the PGRP are to support cutting-edge research that investigates the structure and function of plant genomes and to develop innovative tools, technologies, and resources that are essential to drive plant functional genomics research forward .

Tables

GeneDescription
PGRP-LFA transmembrane protein that negatively regulates the Imd pathway in Drosophila.
PGRP-LCAn essential component of a signal-transducing receptor complex that binds peptidoglycan PAMPs and initiates the cellular response to this PAMP.
PGRP-SAA small, soluble protein that circulates in the hemolymph and is required for activation of a hemolymph protease cascade.
Diap1A negative regulator of apoptosis.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
PGRP-LF; CG4437; Peptidoglycan-recognition protein LF; PGRP-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-369
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
PGRP-LF
Target Protein Sequence
MPKTVVVTHPGKPINNEKRFRFELLYFCVILLMVVGLAAGYFMWMMSFSTHSPNKGLHIL DRSEWLGEPPSGKYPHLKLPVSNIIIHHTATEGCEQEDVCIYRMKTIQAFHMKSFGWVDI GYNFLVGGDGQIYVGRGWHIQGQHVNGYGAISVSIAFIGTFVNMEPPARQIEAAKRLMDE GVRLHRLQPDYHIYAHRQLSPTESPGQKLFELMQNWPRFTQDPTSLRLLSNETVKIVTRP YWLAQPPIVPLTPLKLPIESVRFVATNTPSCFTQAECTFRVRLLQNWHIESNGYKDINYN FVAAGDENIYEARGWDHSCEPPKDADELVVAFIGPSSSNKKIALELIKQGIKLGHISKNY SLIDDLEKS
Uniprot No.

Target Background

Function
Peptidoglycan-recognition protein likely involved in innate immunity through binding to bacterial peptidoglycans (PGN) and subsequent immune response activation.
Gene References Into Functions
  1. PGRP-LF's negative regulation of the NF-κB/IMD pathway is crucial for proper apoptosis induction and normal fly development. PMID: 28085885
  2. The membrane-bound protein exhibits its two PGRP domains, z and w, extracellularly. PMID: 17967349
Database Links

KEGG: dme:Dmel_CG4437

STRING: 7227.FBpp0076167

UniGene: Dm.20049

Protein Families
N-acetylmuramoyl-L-alanine amidase 2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is PGRP-LF and what is its role in Drosophila immunity?

PGRP-LF is a membrane-associated peptidoglycan recognition protein that functions as a specific negative regulator of the immune deficiency (Imd) pathway in Drosophila. Unlike many other PGRPs, PGRP-LF does not directly bind peptidoglycan (PGN) due to the absence of a PGN-docking groove in its PGRP domains (LFz and LFw) . Instead, it prevents spontaneous activation of the Imd pathway by competing with PGRP-LCa for binding to PGRP-LCx, forming non-signaling heterodimers with PGRP-LC isoforms . This regulation is critical for maintaining immune homeostasis as reduction of PGRP-LF levels alone can trigger Imd pathway activation even in the absence of infection .

How is PGRP-LF structurally organized?

PGRP-LF contains two PGRP domains (LFz and LFw) that constitute its ectodomain. Crystal structures of these domains have been determined at 1.72 and 1.94 Å resolution . Unlike other PGRP domains, the structural analysis reveals that LFz and LFw lack a PGN-docking groove, which explains their inability to directly interact with peptidoglycan . PGRP-LF represents one of the "long" PGRPs in Drosophila, characterized by longer transcripts and 5'-untranslated regions compared to "short" PGRPs . Its structure includes a transmembrane region, classifying it as a membrane-spanning protein, which is consistent with its localization and regulatory function at the cell surface .

How does PGRP-LF relate to other members of the PGRP family in Drosophila?

Drosophila expresses 12 PGRP genes distributed across 8 chromosomal loci on the 3 major chromosomes . These are categorized into two classes:

  • Short PGRPs: PGRP-SA, SB1, SB2, SC1A, SC1B, SC2, and SD - characterized by short transcripts and short 5′-untranslated regions, primarily encoding extracellular proteins.

  • Long PGRPs: PGRP-LA, LB, LC, LD, and LE (and LF) - characterized by long transcripts and long 5′-untranslated regions, primarily encoding intracellular and membrane-spanning proteins .

PGRP-LF belongs to the long PGRP group and shares functional similarities with PGRP-LCa, as both are unable to bind peptidoglycan despite containing PGRP domains .

What techniques can be used to study PGRP-LF interactions with other proteins?

Several approaches have proven effective for studying PGRP-LF interactions:

  • Surface Plasmon Resonance (SPR): This technique has been successfully employed to demonstrate that the PGRP-LF ectodomain interacts with the PGRP-LCx ectodomain both in the absence and presence of tracheal cytotoxin (TCT) . SPR data showed that LF interacts with LCx at levels comparable to the interaction between LCx and LCa, and this interaction is enhanced in the presence of TCT .

  • Pull-down and Hold-up Experiments: These biochemical assays have been used to confirm the inability of PGRP-LF domains to bind peptidoglycan .

  • Native Gel Electrophoresis: While not specifically mentioned for PGRP-LF, this technique has been successfully used with other PGRPs to detect protein complexes in the presence of peptidoglycan and could be applicable for studying PGRP-LF interactions .

  • Recombinant Protein Production: Expression of recombinant PGRP domains with appropriate tags (like His-tags) for purification and subsequent interaction studies .

How can researchers effectively produce recombinant PGRP-LF for experimental use?

Based on approaches used for other PGRPs such as PGRP-SC2, the following methodology could be applied to PGRP-LF:

  • Gene Cloning Strategy: Isolate the gene fragment encoding the PGRP domains of interest (LFz and LFw).

  • Expression System: Co-express the target protein with appropriate tags (e.g., N-terminal 10xHis-tag and C-terminal Myc-tag) in E. coli expression systems .

  • Purification Protocol: Use affinity chromatography based on the incorporated tags to achieve >90% purity as determined by SDS-PAGE .

  • Validation: Confirm proper folding and functionality through biochemical assays such as SPR to test interaction with known binding partners like PGRP-LCx .

What is the mechanism by which PGRP-LF prevents spontaneous activation of the Imd pathway?

PGRP-LF prevents spontaneous activation of the Imd pathway through a competitive binding mechanism:

  • Formation of Non-signaling Heterodimers: PGRP-LF forms non-signaling heterodimers with PGRP-LC isoforms at the cell surface .

  • Competition with PGRP-LCa: PGRP-LF competes with PGRP-LCa for binding to PGRP-LCx, reducing the probability of forming signaling LC dimers in the absence of peptidoglycan .

  • Balanced Regulation: In the presence of peptidoglycan fragments like TCT, the number of both LF/TCT/LCx complexes (non-signaling) and LCa/TCT/LCx complexes (signaling) increases, but the pathway can still be activated if sufficient signaling complexes form .

This model is supported by experimental evidence showing that:

  • Removing PGRP-LF in vivo is sufficient to trigger Imd signaling

  • Overexpression of PGRP-LF in flies blocks the induction of antimicrobial peptide synthesis after microbial challenge

What phenotypes are associated with PGRP-LF dysregulation?

Dysregulation of PGRP-LF leads to several significant phenotypes:

  • Constitutive Immune Activation: Reduction of PGRP-LF levels, even without infection, is sufficient to trigger Imd pathway activation, leading to constitutive immune responses .

  • Developmental Impairment: Normal development is impaired in the absence of functional PGRP-LF, a phenotype mediated by the JNK pathway .

  • Dual Pathway Activation: PGRP-LF prevents constitutive activation of both the JNK and Imd pathways, indicating its role as a master regulator of multiple immune signaling pathways .

The table below summarizes the key phenotypic effects observed with PGRP-LF manipulation:

PGRP-LF StatusImd PathwayJNK PathwayDevelopmental EffectsImmune Response
Normal levelsRegulatedRegulatedNormal developmentAppropriate response to infection
Reduced levelsConstitutively activeActivatedImpaired developmentHyperactive immune response
OverexpressionSuppressedNot reportedNot specifically reportedBlocked antimicrobial peptide synthesis after infection

How do the structural features of PGRP-LF domains inform its function?

The crystal structures of PGRP-LF domains (LFz and LFw) at 1.72 and 1.94 Å resolution reveal critical structural features that directly inform function:

  • Absence of PGN-docking Groove: Both LFz and LFw domains lack the peptidoglycan-docking groove found in other PGRP domains, which explains why PGRP-LF cannot directly interact with peptidoglycan .

  • Structural Homology with PGRP-LC: Despite functional differences, PGRP-LF domains show high structural homology with PGRP-LC domains, enabling them to interact with PGRP-LCx and compete with PGRP-LCa .

  • Membrane Association: The structural organization of PGRP-LF as a membrane-associated protein positions it optimally to intercept and regulate PGRP-LC signaling at the cell surface .

These structural features explain the seemingly paradoxical function of PGRP-LF: it belongs to a family of pattern recognition receptors but functions as a negative regulator rather than a pattern sensor.

What experimental approaches are most effective for studying PGRP-LF in vivo?

Based on successful approaches with other PGRPs, the following methods are effective for studying PGRP-LF in vivo:

  • Genetic Manipulation:

    • RNAi-mediated knockdown to study loss-of-function effects

    • Transgenic overexpression to study gain-of-function effects

    • CRISPR/Cas9 gene editing for precise mutations

  • Immune Challenge Assays:

    • Measuring antimicrobial peptide gene expression after microbial challenge in wild-type versus PGRP-LF-manipulated flies

    • Monitoring survival rates after infection

  • Developmental Studies:

    • Assessing developmental progression and viability in the context of PGRP-LF manipulation

  • Protein Localization:

    • Immunohistochemistry or fluorescently tagged PGRP-LF to visualize its localization in different tissues

  • Protein Interaction Studies:

    • Co-immunoprecipitation from fly tissues to confirm in vivo interactions

    • Proximity labeling approaches to identify novel interaction partners

How might knowledge of PGRP-LF function inform therapeutic strategies for immune disorders?

Understanding PGRP-LF function provides insights that could inform therapeutic approaches:

  • Immune Homeostasis Mechanisms: PGRP-LF exemplifies how negative regulation prevents aberrant immune activation, a principle relevant to autoimmune diseases .

  • Structural Basis for Competitive Inhibition: The structural basis for PGRP-LF's competitive inhibition of PGRP-LC signaling could inform the design of peptide or small molecule inhibitors for pathways involved in inflammatory disorders .

  • Evolutionary Conservation: The PGRP family is highly conserved, with homologs in vertebrates including humans . Understanding the Drosophila system provides insights into potential mammalian counterparts.

  • Balanced Regulation Model: The competition model between activating and inhibitory receptors in Drosophila immunity offers a paradigm for understanding similar balances in human immune regulation .

What are emerging areas of research regarding PGRP-LF?

Current frontiers in PGRP-LF research include:

  • Amyloid Formation: Recent research suggests that despite sequence divergence, Drosophila cryptic RHIMs (RIP Homotypic Interaction Motifs) in proteins including PGRP-LC, PGRP-LE, and Imd can form amyloid fibrils in vitro . Investigation of whether PGRP-LF contains similar motifs and how they might influence signaling represents a novel research direction.

  • Microbiome Regulation: Given the role of other PGRPs like PGRP-SC2 in preventing dysbiosis and promoting tissue homeostasis , investigation of PGRP-LF's potential role in gut-microbiome interactions represents an important research frontier.

  • Developmental Regulation: Further exploration of how PGRP-LF prevents developmental defects through regulation of the JNK pathway could provide insights into the intersection of immunity and development .

  • Systemic vs. Local Regulation: Understanding how PGRP-LF functions in different tissues to coordinate systemic and local immune responses remains an area for further research.

How does PGRP-LF interact with other negative regulators of Drosophila immunity?

While not explicitly described in the provided search results, this question represents an important research direction:

  • Coordination with PGRP-SC2: PGRP-SC2 functions as an amidase that degrades bacterial peptidoglycan, acting as a negative regulator of the IMD/Relish innate immune signaling . Research into how PGRP-LF (which prevents receptor activation) coordinates with PGRP-SC2 (which eliminates the ligand) would provide insights into layered immune regulation.

  • Regulatory Network Mapping: Systematic studies of genetic interactions between PGRP-LF and other negative regulators could reveal redundancies and synergies in immune regulation mechanisms.

  • Tissue-Specific Regulation: Investigation of whether different negative regulators predominate in different tissues (e.g., PGRP-LF at systemic level, PGRP-SC2 in the gut) would enhance understanding of compartmentalized immune regulation.

These research questions highlight the complexity of PGRP-LF biology and identify promising avenues for future investigation in the field of Drosophila immunology, with potential implications for understanding conserved immune regulatory mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.