Recombinant Drosophila melanogaster Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme (ninaA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Drosophila melanogaster Peptidyl-Prolyl Cis-Trans Isomerase, Rhodopsin-Specific Isozyme (ninaA)

Recombinant Drosophila melanogaster Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme (ninaA), is a protein that belongs to the peptidyl-prolyl cis-trans isomerase (PPIase) family . PPIases, also known as rotamases, accelerate protein folding by catalyzing the cis-trans isomerization of proline imidic peptide bonds in oligopeptides . NinaA is involved in the folding of rhodopsin RH1 and RH2, but not RH3, and is required for visual transduction .

Gene Information

The ninaA gene, also known as CG3966 in Drosophila melanogaster, encodes for the Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme . Synonyms for the ninaA gene include PPIase . The UniProt ID for ninaA is P15425 .

Production and Characteristics of Recombinant ninaA Protein

Recombinant ninaA protein is produced in E. coli as a full-length protein (21-237aa) fused to an N-terminal His tag . The purity of the recombinant protein is greater than 90% as determined by SDS-PAGE . It is presented as a lyophilized powder from E. coli .

CharacteristicsDetails
SourceE. coli
TagHis tag
Protein LengthFull Length (21-237)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
ApplicationsSDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended .

Function and Role

The ninaA protein plays a crucial role in the visual system of Drosophila melanogaster . It is essential for the proper folding and processing of rhodopsin, the light-sensitive receptor protein in photoreceptor cells . Specifically, ninaA acts as a chaperone, assisting in the cis-trans isomerization of proline residues within rhodopsin, which is necessary for its correct conformation and function .

Synthetic Lethality

A mutation in a novel highly conserved peptidyl prolyl isomerase (PPIase) can selectively eliminate Rbf + cells from the Drosophila eye .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
ninaA; CG3966; Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme; PPIase; Rotamase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-237
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
ninaA
Target Protein Sequence
LSFTVTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRV VDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYV TTVGAKWLDGKHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEIPTEQFEFYP DDFNILGWIKAAGLPVTSSFCVLLIFHYFFRQLNMYC
Uniprot No.

Target Background

Function

Peptidyl-prolyl cis-trans isomerases (PPIases) accelerate protein folding by catalyzing the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. This enzyme plays a crucial role in visual transduction, specifically by acting on the folding of rhodopsins RH1 and RH2 (but not RH3).

Database Links

KEGG: dme:Dmel_CG3966

STRING: 7227.FBpp0077688

UniGene: Dm.19760

Protein Families
Cyclophilin-type PPIase family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed specifically in photoreceptor cells.

Q&A

What is ninaA and what is its function in Drosophila melanogaster?

ninaA is a gene in Drosophila melanogaster that encodes a 237-amino-acid protein with homology to peptidyl-prolyl cis-trans isomerases. The ninaA protein functions as a tissue-specific chaperone essential for rhodopsin biogenesis in photoreceptor cells. Mutations in ninaA cause dramatic reductions in rhodopsin levels, leading to impaired visual function in flies . Specifically, ninaA mutant flies exhibit a 10-fold reduction in rhodopsin levels in the R1-R6 photoreceptor cells . The protein is unique among the cyclophilin family in that it is an integral membrane protein and is expressed in a cell type-specific manner .

What is the relationship between ninaA and rhodopsin processing?

ninaA forms a specific stable protein complex with its target rhodopsin (Rh1) in vivo . In ninaA mutants, Rh1 is retained within the endoplasmic reticulum, and rhodopsin levels are reduced more than 100-fold . Unlike in chromophore-depleted conditions where Rh1 apoprotein accumulates in the ER, ninaA deficiency results in the absence of both Rh1 apoprotein and mature Rh1 . This suggests that ninaA functions early in rhodopsin biogenesis, potentially assisting in proper protein folding and transport through the secretory pathway. The association between ninaA and rhodopsin is remarkably stable - the complex cannot be disrupted even after washing with 2.5M NaCl, indicating a strong molecular interaction .

How does ninaA exhibit substrate specificity among different rhodopsins?

Experimental evidence demonstrates that ninaA has remarkable substrate specificity, even among closely related rhodopsins. Transgenic flies expressing different rhodopsins in photoreceptor cells show that ninaA is required for normal function by two homologous rhodopsins (Rh1 and Rh2), but not by less conserved members of the Drosophila rhodopsin gene family such as Rh3 and Rh4 .

When histidine-tagged Rh3 was expressed in R1-R6 cells (the normal site of ninaA action) and tested for interaction with ninaA, little if any ninaA co-purified with Rh3-His . This highlights the exceptional ability of ninaA to discriminate between related members of the same protein family and suggests specific structural requirements for ninaA-rhodopsin interactions.

What domains of ninaA are critical for rhodopsin interaction and function?

Analysis of ninaA mutants has revealed critical regions for protein function and rhodopsin interaction:

DomainMutationsEffect on BindingEffect on Function
C-terminal (last 6 amino acids)ninaAQ232No stable complex formationStrong loss of function
Transmembrane anchorninaAS219F, ninaAH227LMaintains Rh1 bindingStrong loss of function
Cyclophilin homology domainVarious (G46R, G46E, G88D, etc.)Variable binding capacityVariable severity

The C-terminal six amino acids of ninaA are essential for the interaction with rhodopsin, as demonstrated by the ninaAQ232 mutant that fails to form a stable complex despite localizing to the same cellular compartments as wild-type ninaA . In contrast, mutations in the transmembrane anchor domain (S219F and H227L) maintain the ability to interact with Rh1 but still result in strong ninaA phenotypes, suggesting these regions may be required for interactions with other cellular components essential for ninaA function .

How has the ninaA-rhodopsin complex been isolated and characterized?

Researchers have employed histidine-tagged rhodopsin to isolate and characterize the ninaA-rhodopsin complex. Using transgenic flies expressing rhodopsin with six histidine residues at its C-terminus (Rh1-His), the complex can be purified through nickel affinity chromatography .

The experimental workflow involves:

  • Generating transgenic flies expressing histidine-tagged rhodopsin

  • Solubilizing membrane fractions from fly heads

  • Passing the solubilized fraction through a Ni-NTA affinity column

  • Washing and eluting bound proteins with imidazole

  • Analyzing the components by Western blotting

While untagged rhodopsin from wild-type flies is found exclusively in the flow-through fraction, Rh1-His binds specifically to the Ni-NTA resin. Significantly, ninaA co-purifies with the tagged rhodopsin, confirming their physical interaction . The stability of this interaction is remarkable, as it persists even after washing with high-salt (2.5M NaCl) buffer, indicating a strong, physiologically relevant association .

How can I generate Drosophila models to study ninaA function?

For studying ninaA function in Drosophila, several genetic approaches can be employed:

  • Utilizing existing mutants: Various ninaA alleles with different severity have been characterized (G46R, G46E, G88D, G89S, etc.) . These can be obtained through Drosophila stock centers.

  • Gateway technology for generating tagged constructs: The Drosophila Gateway Vector collection provides a system for expressing epitope-tagged proteins in Drosophila . This system allows you to:

    • Recombine an Open Reading Frame (ORF) of interest into vectors using an in vitro reaction

    • Create fusion genes with your ORF placed in frame with different epitope tags

    • Express the fusion protein under various promoters

  • Transformed recombinant enrichment profiling (TREP): This approach can be used to identify bacterial intracellular invasion genes and may be adapted for studying ninaA interactions . The experimental design includes:

    • Using donor genomic DNA to transform naturally competent cells

    • Pooling recombinant clones and enriching for desired phenotypes

    • Sequencing genomic DNA from pools and calculating allele frequencies

  • Temperature-sensitive alleles: Some ninaA mutants (like C188Y) are temperature-sensitive and can be used to study ninaA function under conditional settings .

What techniques can detect ninaA-rhodopsin interactions in vivo?

Several techniques can be employed to detect and characterize ninaA-rhodopsin interactions:

  • Affinity purification with tagged proteins: As demonstrated by Baker et al., expressing histidine-tagged rhodopsin allows for isolation of the ninaA-rhodopsin complex using nickel affinity chromatography . This approach can be adapted for other tagging systems.

  • Western blotting: After affinity purification, Western blotting with antibodies specific to ninaA and rhodopsin can confirm co-purification of the proteins .

  • Subcellular localization studies: Immunofluorescence or GFP-tagging can be used to visualize the co-localization of ninaA and rhodopsin in cellular compartments such as the ER and transport vesicles .

  • UV photochemical cross-linking: This technique can be employed to stabilize protein-protein interactions before isolation .

  • DNaseI protection assay: Although typically used for DNA-protein interactions, this approach can be modified to study protein complex formation in certain contexts .

How can I quantitatively assess rhodopsin maturation in ninaA studies?

Quantitative assessment of rhodopsin maturation can be performed using several approaches:

  • Western blotting: Rhodopsin exists in two forms that can be distinguished by Western blotting - the immature, high-molecular-weight endo-H-sensitive form and the mature, deglycosylated form . The ratio between these forms provides insight into the efficiency of rhodopsin maturation.

  • Electron microscopy: The morphology of photoreceptor cells, particularly the presence of ER cisternae, can serve as an indicator of rhodopsin processing efficiency. ninaA mutants show overproliferation of ER membranes due to rhodopsin retention .

  • Controlled expression systems: Using inducible promoters (like heat-shock promoters) to vary ninaA levels can demonstrate the quantitative relationship between ninaA expression and rhodopsin maturation . In experiments with heat-shock-inducible ninaA expression, higher levels of ninaA protein resulted in higher levels of mature rhodopsin .

  • Pulse-chase experiments: These can be used to track the progression of newly synthesized rhodopsin through the secretory pathway under different experimental conditions.

How does the ratio of rhodopsin:ninaA affect photoreceptor morphology?

Research has demonstrated a quantitative relationship between rhodopsin:ninaA ratios and photoreceptor cell morphology:

  • Wild-type flies (normal rhodopsin:ninaA ratio): Display normal photoreceptor morphology with efficient rhodopsin processing .

  • Heterozygous ninaA mutants (two copies of rhodopsin gene, one copy of functional ninaA): Develop significant increases in ER cisternae, indicating accumulation of rhodopsin in the ER .

  • Double heterozygotes (one functional copy each of ninaA and rhodopsin): Re-establish the wild-type ratio and display normal photoreceptor morphology .

These findings demonstrate that a 50% reduction in ninaA levels is sufficient to cause rhodopsin accumulation in the ER, suggesting a non-enzymatic, stoichiometric role for ninaA in rhodopsin processing .

What is the relationship between ninaA mutation and retinal degeneration?

dPob/EMC3 deficiency (a related protein involved in rhodopsin processing) has been shown to induce rhabdomere degeneration in a light-independent manner . Similarly, ninaA mutations can lead to retinal degeneration due to the accumulation of misfolded rhodopsin in the ER .

The accumulation of rhodopsin in the ER, evidenced by the proliferation of ER membranes in ninaA mutants, puts stress on the cell that can ultimately lead to cell death and tissue degeneration . This demonstrates that proper protein folding and trafficking mediated by chaperones like ninaA are essential for photoreceptor cell health and survival.

How does ninaA relate to other components of rhodopsin processing machinery?

Several proteins work in concert with ninaA for proper rhodopsin processing:

  • Calnexin (Cnx): Another ER chaperone involved in rhodopsin processing. Genetic studies indicate that Cnx is epistatic to ninaA, suggesting it acts upstream in the rhodopsin processing pathway .

  • dPob/EMC3, EMC1, and EMC8/9: Components of the ER membrane protein complex (EMC) that are essential for stabilizing immature Rh1 at an earlier step than ninaA . In double mutants, dPob/EMC3 is epistatic to ninaA, indicating it functions earlier in the rhodopsin processing pathway .

This hierarchical relationship suggests a sequential process of rhodopsin maturation, with EMC components acting first, followed by ninaA, in facilitating the proper folding and transport of rhodopsin through the secretory pathway.

How conserved is ninaA across species?

ninaA shows remarkable evolutionary conservation, sharing over 40% amino acid sequence identity with vertebrate cyclophilins . This conservation suggests fundamental importance in cellular processes across diverse organisms.

Studies have demonstrated that vertebrate retina contains a ninaA-related protein, indicating evolutionary conservation of this specialized cyclophilin in visual systems . Additionally, ninaA is part of a gene family in Drosophila, suggesting potential functional diversification of cyclophilins within the organism .

The high degree of conservation makes ninaA an excellent model for studying the in vivo roles of cyclophilins, with potential implications for understanding cyclophilin function in other organisms, including humans.

What insights can ninaA provide for human disease research?

As a specialized cyclophilin involved in protein folding and transport, ninaA research offers several insights relevant to human disease:

  • Protein misfolding disorders: The ninaA model demonstrates how chaperone deficiencies can lead to protein accumulation and cellular stress, similar to mechanisms in human neurodegenerative diseases involving protein misfolding.

  • Retinal degeneration: Understanding how ninaA mutations lead to retinal degeneration in Drosophila may provide insights into human retinal degenerative diseases, particularly those involving rhodopsin misfolding such as certain forms of retinitis pigmentosa.

  • Cyclophilin-targeted therapeutics: The availability of mutations in a cyclophilin gene provides a model system for studying cyclophilin and cyclosporin action , potentially informing the development of cyclophilin-targeted therapeutics for human diseases.

  • ER stress responses: ninaA mutants exhibit ER stress due to rhodopsin accumulation, offering a model to study ER stress responses relevant to numerous human diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.