Recombinant Drosophila melanogaster Phosphatidylinositide phosphatase SAC1 (Sac1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Drosophila melanogaster Phosphatidylinositide Phosphatase SAC1 (Sac1)

Recombinant Drosophila melanogaster Phosphatidylinositide phosphatase SAC1 (Sac1) is a recombinant protein derived from the fruit fly (Drosophila melanogaster) and produced using an in vitro E. coli expression system . It is a phosphatase enzyme that acts on phosphoinositides, particularly phosphatidylinositol 3-phosphate (PtdIns(3)P) and phosphatidylinositol 4-phosphate (PtdIns(4)P). It exhibits low activity towards phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2).

Synonyms

Sac1 is also known by several other names, including Sacm1l, CG9128, Phosphatidylinositol-3-phosphatase SAC1, Phosphatidylinositol-4-phosphate phosphatase, and Suppressor of actin mutations 1-like protein.

Function and Subcellular Localization

Sac1 is an essential, conserved endoplasmic reticulum (ER)-localized phosphatase . Its primary function involves the hydrolysis of PtdIns(3)P and PtdIns(4)P. Sac1 influences various cellular processes, including secretory trafficking, plasma membrane homeostasis, actin organization, vacuole morphology, and sphingomyelin synthesis . It is found in the endoplasmic reticulum membrane and Golgi apparatus membrane as a multi-pass membrane protein.

Role in Cellular Homeostasis and Development

Sac1 plays a crucial role in maintaining cellular homeostasis during tissue development . Studies in Drosophila have shown that Sac1 is essential for the structural integrity of the retina . Loss of Sac1 function leads to defects in cell shape and ectopically activated JNK signaling, which prevents dorsal closure during embryonic development . Sac1 also regulates Hedgehog signaling by inhibiting the recruitment and activation of Smoothened at the plasma membrane in a PI4P-dependent manner .

Impact on Protein Trafficking and ER Stress

Accumulation of proteins like Roughest (Rst) and Kirre within Sac1 mutant retinal cells indicates impaired endo-lysosomal degradation . Loss of Sac1 induces ER stress and the unfolded protein response (UPR) in Drosophila retinal cells . VAP, which recruits OSBP to the ER to deliver PI4P to Sac1, is important for ER homeostasis in Drosophila .

Interaction with DVAP and Implications in ALS

Sac1 interacts with Drosophila VAP (DVAP), and this interaction is crucial for maintaining normal levels of phosphoinositides . Downregulating either Sac1 or DVAP disrupts axonal transport, synaptic growth, synaptic microtubule integrity, and the localization of several postsynaptic components . Expression of a disease-causing allele (DVAP-P58S) in a fly model for amyotrophic lateral sclerosis 8 (ALS8) induces neurodegeneration and synaptic defects, similar to those observed with Sac1 or DVAP downregulation .

Sac1 and Phosphoinositide Levels in ALS Pathogenesis

Sac1 downregulation induces neurodegeneration in a dosage-dependent manner . Sac1 is sequestered into DVAP-P58S-induced aggregates, and reducing phosphoinositide levels rescues the neurodegeneration and suppresses the synaptic phenotypes associated with DVAP-P58S transgenic expression .

Sac1 in Eye Development

The phosphoinositide phosphatase Sac1 regulates cell shape and microtubule stability in the developing Drosophila eye . Loss of Sac1 causes severe tissue disorganization and degeneration during eye development .

Sac1 and Axon Guidance

Sac1 regulates axon guidance in the embryonic Drosophila central nervous system (CNS). Sac1 is required for axonal pathfinding in the embryonic central nervous system, as well as for axonal transport and synaptogenesis in larval neurons .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance, incurring additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Sac1; Sacm1l; CG9128; Phosphatidylinositol-3-phosphatase SAC1; Phosphatidylinositol-4-phosphate phosphatase; Suppressor of actin mutations 1-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-592
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Sac1
Target Protein Sequence
MDSREENAVYDDMNLYIAPQSFIIEPNGGDELLVIGRHDKVTRVQPASGGLVANLRPTRR ICGVLGTIHLLSCDYLLVATHRLFVGVLNGAVVWRLAGYDIIPYIPNSFQRKENENYLRL LRQTLDTKFFYFSYRYDLTNSLQRQREVAQSRPEVSGLLQRAEQRFVWNGYVLRQFNCDK MEKFQLPLVLGFVSINQVQINGQTFFWSIITRRSVQRAGTRLFCRGSDEQGHVANFVETE QIVEFNGQLTGFVQTRGSMPFHWHQLPNLRYKPRPVLVPGKDHLAACGLHFKEQIRLYGN NVAVNLVDHKGAEGELEATYARLVREMGNPQVRYESFDFHSECRKMRWDRLNILIDRLAH EQDQFGVYHVFDDGKLVSTQTGVFRTNCIDCLDRTNVVQSMLARRSLTAVLQKLGVLHVG QKVEHASDIFESIFKGVWADNADLVSLQYSGTCALKTDFTRTGKRTKSGAMQDGKNSLMR YYLNNFADGQRQDSIDLFLGKYLVNDNEGGAVPSPLESKHGWRFFTFPSVLLVAVAMFMI TMTYPAEFNTENLLFMLFWGAMIAVSATGILHYGVEFVQWPRLFPPISFRDP
Uniprot No.

Target Background

Function
Phosphatidylinositol phosphatase that catalyzes the hydrolysis of phosphatidylinositol 3-phosphate (PtdIns(3)P) and phosphatidylinositol 4-phosphate (PtdIns(4)P). Exhibits low activity towards phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2).
Gene References Into Functions
  1. Evidence indicates Sac1 regulates axon guidance in the embryonic Drosophila CNS. PMID: 22042447
  2. This study represents the first reported role of Sac1 in multicellular organism development. PMID: 14588244
Database Links

KEGG: dme:Dmel_CG9128

STRING: 7227.FBpp0292309

UniGene: Dm.4642

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of Drosophila SAC1 protein?

Drosophila SAC1 is a transmembrane phosphoinositide phosphatase with both N- and C-terminal domains exposed to the cytosol. The protein contains a conserved Sac phosphatase domain consisting of seven motifs, with the sequence CXDCLDRT within the sixth motif defining the catalytic core. The N-terminal domain (approximately 520 amino acids) is significantly longer than the C-terminal domain (approximately 20 amino acids). Structural topology studies indicate SAC1 is a dual-pass transmembrane protein that localizes primarily to the endoplasmic reticulum (ER) and Golgi apparatus, with localization patterns that vary depending on cellular conditions .

What are the primary cellular functions of Drosophila SAC1?

Drosophila SAC1 serves multiple critical functions:

  • Regulation of phosphoinositide homeostasis, particularly PI4P levels

  • Maintenance of ER homeostasis and protein trafficking

  • Regulation of membrane trafficking between the ER and Golgi

  • Cytoskeletal organization and cell adhesion

  • Participation in neuronal development, particularly axon guidance

  • Regulation of autophagosome-lysosome fusion

  • Maintenance of tissue integrity, especially in retinal development

These functions are largely dependent on SAC1's phosphatase activity, which hydrolyzes phosphatidylinositol-4-phosphate (PI4P) .

How is SAC1 expression regulated during Drosophila development?

SAC1 exhibits dynamic expression patterns during Drosophila development. Immunohistochemical analysis reveals abundant expression during early embryogenesis (stage 3), suggesting strong maternal contribution. At later developmental stages (13 and 16), SAC1 expression becomes highly restricted to the developing central nervous system (CNS) and peripheral nervous system (PNS). Within the CNS, SAC1 is specifically expressed on three longitudinal axon tracts defined by the cell adhesion molecule Fasciclin II (Fas II). In stage 13 embryos, strong SAC1 immunoreactivity is also found in the dorsal epidermis, consistent with its reported role in dorsal closure. This temporal and spatial regulation of SAC1 expression aligns with its diverse developmental functions .

What factors influence SAC1 subcellular localization in Drosophila cells?

SAC1 subcellular localization is dynamically regulated by nutritional and growth conditions. In serum-rich conditions, SAC1 predominantly localizes to the ER, while under nutrient starvation, it relocates to the Golgi apparatus. This translocation appears to be regulated at the level of retrieval from the Golgi rather than ER export, as in vitro budding assays show comparable efficiency of SAC1 export from the ER in both starved and non-starved conditions. The sorting motif (RLSNTSP) within the N-terminal domain is critical for proper trafficking. Additionally, interactions with proteins like 14-3-3 facilitate SAC1 export in COPII vesicles. This regulated localization allows SAC1 to control PI4P levels at different cellular compartments in response to changing environmental conditions .

What are the most effective methods for generating recombinant Drosophila SAC1 for in vitro studies?

For successful production of recombinant Drosophila SAC1:

  • Expression system selection: The bacterial expression system using E. coli BL21(DE3) is suitable for producing the soluble N-terminal domain, while full-length transmembrane SAC1 typically requires eukaryotic systems such as insect cells (Sf9 or High Five).

  • Construct design:

    • For catalytic studies: Express the catalytic domain (amino acids 1-520) with an N-terminal tag

    • For interaction studies: Use the full-length protein with appropriate epitope tags (3× HA tag at N-terminus has proven effective)

    • Include the CXDCLDRT catalytic core region (within motif six)

  • Purification strategy:

    • Use affinity chromatography with His or GST tags

    • Follow with size exclusion chromatography for higher purity

    • Supplement buffers with reducing agents to maintain cysteine residues in the catalytic site

  • Activity verification: Assess phosphatase activity using in vitro phosphoinositide hydrolysis assays, comparing wild-type to catalytically inactive mutants (C392S has been validated) .

What approaches can be used to study SAC1 function in vivo in Drosophila?

Several complementary approaches have proven effective:

  • Genetic approaches:

    • Temperature-sensitive alleles (e.g., Sac1^ts) allow temporal control of SAC1 inactivation

    • Null mutants (complete knockout) for early developmental studies

    • Tissue-specific knockdown using UAS-RNAi lines with appropriate GAL4 drivers

    • Genetic rescue experiments with wild-type or mutant SAC1 constructs

  • Phenotypic analysis:

    • Immunohistochemistry to assess protein localization and tissue morphology

    • Live imaging of fluorescently tagged proteins to monitor trafficking

    • Electron microscopy to examine subcellular structure

    • Behavioral assays for neuronal function assessment

  • Biochemical approaches:

    • Co-immunoprecipitation to identify interaction partners

    • Western blotting to assess protein levels

    • Lipidomics to measure phosphoinositide levels

  • Cell-based assays:

    • S2 cell culture for RNAi and protein localization studies

    • In vitro vesicle budding reactions to study trafficking .

How does SAC1 regulate midline axon guidance in the Drosophila CNS?

SAC1 plays a critical role in midline axon repulsion through regulation of phosphoinositide signaling in the following manner:

  • Mechanism: SAC1 regulates PI4P levels at the neuronal membrane, which affects the Slit/Robo repulsive signaling pathway. This phosphatase activity is essential, as catalytically-inactive SAC1 mutants fail to rescue midline crossing defects.

  • Genetic interactions: SAC1 displays dosage-sensitive genetic interactions with the genes encoding the midline repellent Slit and its axonal receptor Robo. This suggests SAC1 functions within or parallel to the Slit/Robo pathway.

  • Phenotypic effects: Mutations in the sac1 gene cause ectopic midline crossing of Fasciclin II (Fas II)-positive axon tracts, which normally do not cross the midline. This phenotype can be rescued by neuronal expression of wild-type SAC1 but not by a catalytically-inactive mutant.

  • Cellular expression: SAC1 is expressed on three longitudinal axon tracts that are defined by Fas II, positioning it appropriately to regulate midline crossing.

These findings suggest that SAC1-mediated regulation of phosphoinositides is critical for proper Slit/Robo-dependent axon repulsion at the CNS midline, likely by modulating the cellular response to repulsive cues .

What is the relationship between SAC1 dysfunction and neurological disorders?

SAC1 dysfunction has been implicated in several neurological conditions:

  • Amyotrophic Lateral Sclerosis (ALS): Down-regulation of Drosophila vesicle-associated protein or SAC1 in Drosophila leads to pathogenesis associated with ALS. This suggests SAC1's role in membrane trafficking is crucial for motor neuron health.

  • Axonal pathfinding disorders: SAC1 is required for axonal pathfinding in the embryonic central nervous system, as well as for axonal transport and synaptogenesis in larval neurons. Mutations lead to miswiring in the nervous system.

  • ER stress-related neurodegeneration: Loss of SAC1 induces ER stress and unfolded protein response (UPR) in Drosophila photoreceptor cells, mechanisms implicated in various neurodegenerative diseases.

  • Retinal degeneration: SAC1 mutations cause severe tissue disorganization and degeneration during eye development, which shares features with human retinal degenerative disorders.

The evolutionary conservation of SAC1 from Drosophila to humans suggests these findings may have direct relevance to human neurological diseases, particularly those involving ER stress, axonal transport defects, or phosphoinositide dysregulation .

How does SAC1 contribute to ER homeostasis in Drosophila cells?

SAC1 maintains ER homeostasis through several mechanisms:

  • PI4P regulation: As a phosphoinositide phosphatase, SAC1 hydrolyzes PI4P at the ER membrane, maintaining proper phosphoinositide balance. Deregulation of PI4P levels in SAC1 mutants disrupts ER function.

  • Protein folding and trafficking: SAC1 facilitates proper protein folding and trafficking of newly synthesized proteins out of the ER. In temperature-sensitive SAC1 mutants, proteins like Roughest and Kirre accumulate abnormally due to impaired processing.

  • ER stress prevention: SAC1 deficiency leads to activation of the unfolded protein response (UPR), indicating its critical role in preventing ER stress. This is particularly evident in Drosophila photoreceptor cells.

  • Interaction with VAP: SAC1 collaborates with VAP (VAMP-associated protein), which recruits OSBP (oxysterol-binding protein) to the ER to deliver PI4P to SAC1 for hydrolysis. This interaction is essential for maintaining ER structure and function.

  • Membrane contact sites: SAC1 functions at membrane contact sites between the ER and other organelles, facilitating lipid exchange and maintaining organelle identity.

These functions highlight SAC1's central role in coordinating lipid homeostasis with protein processing in the ER, explaining why SAC1 disruption leads to diverse cellular defects .

What is the role of SAC1 in autophagy regulation?

SAC1 serves as a critical regulator of autophagy through the following mechanisms:

  • Autophagosome-lysosome fusion: SAC1 is essential for autophagosome-lysosome fusion through its PtdIns4P phosphatase activity. In yeast, SAC1 deficiency causes failure of autophagosomes to fuse with vacuoles.

  • Control of PtdIns4P localization: SAC1 prevents abnormal incorporation of PtdIns4P into Atg9 vesicles and autophagosomes. When SAC1 is deficient, PtdIns4P dramatically increases at the early Golgi apparatus and inappropriately incorporates into autophagy-related membranes.

  • SNARE protein recruitment: Proper PI4P distribution regulated by SAC1 is necessary for recruiting SNARE proteins that mediate fusion events in the autophagy pathway. Without SAC1, these proteins fail to localize correctly.

  • Evolutionary conservation: SAC1's function in autophagy is highly conserved from yeast to mammalian cells, underscoring its fundamental importance in this cellular process.

These findings suggest that SAC1 plays a surveillance role in lipid integration during autophagy, ensuring that the correct phosphoinositide composition is maintained for successful autophagosome-lysosome fusion .

How does SAC1 influence eye development in Drosophila?

SAC1 regulates multiple aspects of Drosophila eye development:

  • Retinal floor integrity: SAC1 is required for structural integrity of the Drosophila retinal floor. Temperature-sensitive SAC1 mutants show defects in retinal morphology.

  • Cell adhesion regulation: In SAC1 mutants, the β-ps-integrin Myospheroid, which is necessary for basal cell adhesion, is mislocalized. Additionally, the adhesion proteins Roughest and Kirre accumulate within retinal cells due to impaired endo-lysosomal degradation.

  • Interommatidial cell patterning: SAC1 is required for proper patterning of interommatidial cells (IOCs). SAC1^ts mutants have rough eyes and retinal patterning defects.

  • ER homeostasis in photoreceptors: SAC1 maintains ER homeostasis in retinal cells, which is critical for proper development and function of photoreceptors.

  • Hedgehog signaling modulation: SAC1 regulates Hedgehog signaling by inhibiting recruitment and activation of Smoothened at the plasma membrane in a PI4P-dependent manner, affecting eye development.

These diverse roles highlight SAC1's importance in coordinating membrane dynamics, protein trafficking, and cell adhesion during the complex process of eye development, explaining why SAC1 mutations lead to severe eye phenotypes .

What methodological approaches can reveal SAC1's function in tissue morphogenesis?

To investigate SAC1's role in tissue morphogenesis:

  • Live imaging techniques:

    • Fluorescently tagged proteins (GFP-SAC1) to monitor dynamic localization

    • Multi-channel imaging to simultaneously track SAC1 and interacting proteins

    • Time-lapse microscopy to capture developmental processes in real-time

  • Genetic mosaic analysis:

    • FLP/FRT system to generate clonal patches of SAC1 mutant cells

    • MARCM (Mosaic Analysis with a Repressible Cell Marker) for positively marking mutant clones

    • Twin-spot analysis to compare mutant and wild-type tissues side-by-side

  • Tissue-specific perturbations:

    • GAL4/UAS system for targeted expression or knockdown

    • Temperature-sensitive alleles for temporal control

    • Optogenetic tools for acute inactivation

  • Multi-omics approaches:

    • Lipidomics to measure phosphoinositide levels

    • Proteomics to identify SAC1-interacting proteins

    • Transcriptomics to assess downstream effects

  • Advanced microscopy:

    • Super-resolution microscopy for subcellular localization

    • Transmission electron microscopy for ultrastructural analysis

    • Correlative light and electron microscopy (CLEM)

These complementary approaches can provide a comprehensive understanding of how SAC1 coordinates cellular processes during tissue morphogenesis .

How can Drosophila SAC1 mutants serve as models for human diseases?

Drosophila SAC1 mutants offer valuable models for several human pathologies:

  • Neurodegenerative disorders:

    • SAC1 has been linked to amyotrophic lateral sclerosis (ALS) pathogenesis

    • Neuronal-specific SAC1 mutations in flies show axonal transport defects and synaptogenesis abnormalities

    • ER stress induced by SAC1 mutation mirrors mechanisms in human neurodegenerative diseases

  • Developmental disorders:

    • SAC1 mutations affect axon guidance and neural circuit formation

    • Eye development defects provide models for human retinal disorders

    • Cell adhesion defects mimic aspects of epithelial disorders

  • Metabolic disorders:

    • Phosphoinositide dysregulation in SAC1 mutants parallels lipid metabolism disorders

    • Autophagy defects model lysosomal storage diseases

  • Research advantages:

    • High conservation of SAC1 function between flies and humans

    • 77% of human disease genes have Drosophila counterparts

    • Availability of sophisticated genetic tools in Drosophila

    • Ability to perform large-scale genetic screens for modifiers

The Homophila database (http://homophila.sdsc.edu) can be used to identify human disease genes related to SAC1, facilitating translational research between Drosophila models and human conditions .

What are the methodological considerations for designing rescue experiments with SAC1 mutants?

When designing SAC1 rescue experiments, consider these methodological approaches:

  • Construct design considerations:

    • Use wild-type SAC1 as positive control

    • Include catalytically inactive mutants (C392S replacing conserved cysteine in CXDCLDRT motif)

    • Create domain-specific mutants (e.g., trafficking signal mutants)

    • Consider tagged versions (N-terminal tags preferred as C-terminus is short)

  • Expression system selection:

    • UAS-GAL4 system for tissue-specific expression

    • Temperature-inducible systems for temporal control

    • Endogenous promoter constructs for physiological expression levels

  • Delivery methods:

    • Germline transformation for stable transgenic lines

    • For acute studies, consider heat-shock promoters or drug-inducible systems

  • Experimental controls:

    • Include wild-type SAC1 expression in wild-type background to check for overexpression effects

    • Use multiple independent transgenic lines to control for position effects

    • Quantify expression levels relative to endogenous SAC1

  • Phenotypic assessment:

    • Evaluate multiple phenotypes (cellular, tissue-level, behavioral)

    • Perform dose-response studies with varying expression levels

    • Assess timing requirements through stage-specific rescues

For example, neuronal expression of UAS-HA-sac1-WT using elav-GAL4 substantially rescued the midline crossing phenotype in sac1^1/sac1^2 mutants, while catalytically inactive mutants failed to rescue, demonstrating the importance of phosphatase activity for this function .

What is the relationship between SAC1 and phosphoinositide signaling networks in Drosophila?

SAC1 functions as a key regulatory node in phosphoinositide signaling networks:

  • Substrate specificity and regulation:

    • SAC1 primarily hydrolyzes phosphatidylinositol-4-phosphate (PI4P)

    • The catalytic core sequence CXDCLDRT is essential for activity

    • Activity is regulated by cellular conditions and protein interactions

  • Spatial regulation of phosphoinositide pools:

    • SAC1 controls PI4P levels at the ER and Golgi

    • Its dynamic localization between these compartments allows responsive regulation

    • Creates distinct phosphoinositide territories essential for organelle identity

  • Pathway integration:

    • Interacts with Slit/Robo signaling in axon guidance

    • Modulates Hedgehog signaling by regulating Smoothened recruitment

    • Affects endo-lysosomal trafficking of signaling receptors

  • Downstream effectors:

    • Controls recruitment of proteins with PI4P-binding domains

    • Influences SNARE protein localization for membrane fusion

    • Affects cytoskeletal organization through phosphoinositide-binding proteins

  • Feedback mechanisms:

    • SAC1 activity can be regulated by its product PI

    • Stress conditions alter SAC1 localization and activity

    • Growth factors influence SAC1 trafficking between compartments

This central role in phosphoinositide homeostasis explains why SAC1 dysfunction impacts multiple cellular processes and developmental events .

How do mutation rates and genetic variation affect studies of SAC1 in Drosophila populations?

Understanding mutation rates and genetic variation is critical for SAC1 research:

This population genetic context is essential for interpreting phenotypic variation in SAC1 studies and designing experiments with appropriate controls .

What are the key interaction partners of SAC1 in Drosophila cells?

SAC1 participates in multiple protein-protein interactions that regulate its function:

  • Vesicle trafficking components:

    • COPII coat proteins for ER export

    • 14-3-3 proteins facilitate SAC1 export in COPII vesicles

    • VAMP-associated proteins (VAPs) at ER membrane contact sites

  • Lipid transfer proteins:

    • Oxysterol-binding protein (OSBP) delivers PI4P to SAC1

    • Other lipid transfer proteins that function at membrane contact sites

  • Signaling pathway components:

    • Genetic interactions with Slit and Robo in axon guidance

    • Components of the Hedgehog signaling pathway

    • JNK signaling pathway members

  • Cell adhesion machinery:

    • Indirect regulation of Roughest and Kirre adhesion proteins

    • Influences localization of β-ps-integrin Myospheroid

  • ER stress response factors:

    • Proteins involved in the unfolded protein response (UPR)

    • ER quality control machinery

These interactions place SAC1 at the nexus of membrane trafficking, lipid homeostasis, and signaling pathways, explaining its diverse cellular functions .

What experimental approaches can identify novel SAC1 binding partners in Drosophila?

To identify novel SAC1 binding partners, researchers can employ these methodologies:

  • Proteomic approaches:

    • Immunoprecipitation followed by mass spectrometry (IP-MS)

    • BioID or TurboID proximity labeling with SAC1 as bait

    • Cross-linking mass spectrometry for transient interactions

    • APEX2 proximity labeling for compartment-specific interactions

  • Genetic screens:

    • Modifier screens in sensitized SAC1 mutant backgrounds

    • Synthetic lethality screens with SAC1 hypomorphs

    • RNAi screens for genes affecting SAC1 localization

  • Yeast two-hybrid (Y2H) assays:

    • Using cytosolic domains of SAC1 as bait

    • Split-ubiquitin systems for membrane protein interactions

    • According to comprehensive Drosophila TF interaction studies, Y2H can detect novel interactions with ~17% sensitivity and ~1.2% false-positive rate

  • In vitro binding assays:

    • Pull-down assays with recombinant SAC1 domains

    • Surface plasmon resonance for quantitative binding parameters

    • AlphaScreen or ELISA-based interaction studies

  • Imaging-based approaches:

    • Förster resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation (BiFC)

    • Fluorescence correlation spectroscopy

These approaches can be complemented with bioinformatic analyses to predict interactions based on conserved domains and co-evolution patterns. For membrane proteins like SAC1, techniques specifically designed for transmembrane proteins should be prioritized .

What are the major challenges in producing functionally active recombinant Drosophila SAC1?

Producing functional recombinant SAC1 presents several technical challenges:

  • Membrane protein expression issues:

    • As a transmembrane protein, full-length SAC1 is difficult to express in soluble form

    • Risk of improper folding and aggregation

    • Challenges in replicating proper membrane environment

  • Catalytic activity preservation:

    • The CXDCLDRT catalytic core contains essential cysteine residues sensitive to oxidation

    • Activity can be lost during purification

    • Requires appropriate substrate presentation for activity assays

  • Protein stability concerns:

    • Temperature sensitivity (reflected in temperature-sensitive alleles)

    • Potential proteolytic sensitivity

    • Storage stability challenges

  • Solutions and strategies:

    • Express soluble domains separately (N-terminal domain contains catalytic activity)

    • Use mild detergents or nanodiscs to maintain native structure

    • Include reducing agents to protect catalytic cysteines

    • Employ rapid purification protocols to minimize activity loss

    • Consider insect cell expression for full-length protein

    • Validate activity immediately after purification

    • Monitor protein quality by size-exclusion chromatography

  • Activity verification approaches:

    • Develop robust phosphatase assays with defined substrates

    • Compare wild-type to catalytically inactive mutants (C392S)

    • Assess binding to known interaction partners

These strategies can overcome the inherent difficulties in working with this complex transmembrane phosphatase .

How can researchers overcome technical limitations in studying SAC1 in vivo?

Researchers can address technical challenges in studying SAC1 in vivo through these approaches:

  • Genetic manipulation strategies:

    • Use temperature-sensitive alleles to bypass embryonic lethality

    • Generate tissue-specific CRISPR knockouts

    • Employ GAL80^ts for temporal control of GAL4-driven constructs

    • Create knock-in lines with minimally disruptive tags

  • Imaging challenges solutions:

    • Super-resolution microscopy for precise localization

    • Optimized fixation methods to preserve membrane structures

    • Live imaging with minimally disruptive fluorescent tags

    • RUSH (Retention Using Selective Hooks) system to synchronize protein trafficking

  • Phosphoinositide detection methods:

    • PI4P biosensors based on specific binding domains

    • Optimized fixation for immunostaining with anti-PI4P antibodies

    • Biochemical extraction and analysis of phosphoinositides

    • Mass spectrometry-based lipidomics approaches

  • Protein-protein interaction validation:

    • Proximity ligation assay (PLA) for in situ interaction detection

    • Split reporters for monitoring interactions in vivo

    • Co-immunoprecipitation optimized for membrane proteins

  • Functional readouts:

    • Develop specific phenotypic assays for SAC1 activity

    • Utilize phospho-specific antibodies for downstream effectors

    • Establish cellular stress reporters relevant to SAC1 function

These approaches enable researchers to overcome the challenges inherent in studying a multifunctional membrane protein involved in essential developmental and cellular processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.