Recombinant Drosophila melanogaster Post-GPI attachment to proteins factor 3 (CG3271)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will accommodate your request whenever possible.
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us. We will prioritize developing the specified tag if possible.
Synonyms
PGAP3; CG3271; Post-GPI attachment to proteins factor 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-326
Protein Length
Full Length of Mature Protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
PGAP3
Target Protein Sequence
SNGDRTQFFHNCRQNCERTNCSADGLEIQEQAVKFYQQSVFDRLFQWSCADECQYGCMWR
TVFAFFERGWPIPQFYGKWPFLRLLGMQEPASVIFSCLNFVVHLRLLRKFRREVRPDSPC
YMLTHIFAVTSLNGWIWSAIFHTRDFPLTELLDYAFAYSIILCSLYVMVMRMLHRYSLFL
RGVITLAFLSYYINYFAYLSVGRFNYAFNMMVNVATGVIAAVGWFVWCHFVRTRRPYFRR
ILRFYILMALAMSLELLDFPPILWILDAHALWHLATIPLASLYYECVEILLYSNIATCVC
ILAS
Uniprot No.
Target Background
Function
This protein is involved in the lipid remodeling steps of GPI-anchor maturation.
Database Links
KEGG: dme:Dmel_CG3271
UniGene: Dm.495
Protein Families
PGAP3 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
