Recombinant Drosophila melanogaster Probable G-protein coupled receptor Mth-like 10 (mthl10)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Drosophila

Mthl10 integrates metabolic, immunological, and stress-response pathways through GBP binding:

Innate Immune Regulation

  • Antimicrobial Peptide (AMP) Production: Mthl10 knockdown in S2 cells reduces GBP-induced expression of AMPs like Metchnikowin (Mtk) and Diptericin (Dpt) .

  • Infection Resistance: Flies with Mthl10 knockdown exhibit 2–3× higher mortality after Micrococcus luteus infection compared to controls .

Stress Adaptation

  • Cold stress (4°C for 16 h) elevates Mtk expression in larvae, which is attenuated by Mthl10 knockdown .

Metabolic Homeostasis

  • Mthl10 mediates GBP-dependent insulin-like peptide (ILP) secretion in the brain, linking nutrient status to insulin signaling .

Lifespan Implications

Mthl10 activity inversely correlates with longevity:

  • Lifespan Extension: Mthl10 knockdown extends median lifespan by 12–25% (greater in females) .

  • Lifespan Reduction: Overexpression of GBP shortens lifespan by 10–16%, an effect abolished by Mthl10 knockdown .

Mechanistic Insights from Studies

  • Ca²⁺ Signaling: Mthl10 mediates GBP-induced Ca²⁺ mobilization via phospholipase C (PLC), with 85% signal reduction upon receptor knockdown .

  • Ligand Binding: Fluorescence polarization assays confirm GBP binding to recombinant Mthl10 ectodomain with an affinity of ~6 μM .

Evolutionary Context

Mthl10 originated from the first duplication event in the Mth superclade, predating the emergence of Mth. While Mth underwent further duplications, Mthl10 retained ancestral roles in longevity and homeostasis .

Research Applications

  • Immune-Metabolic Studies: Used to dissect cytokine crosstalk between stress responses and metabolism .

  • Aging Research: Models trade-offs between stress resilience and lifespan .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time estimates, kindly consult your local distributors.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mthl10; mth2; CG17061; Probable G-protein coupled receptor Mth-like 10; Protein methuselah-like 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-585
Protein Length
Full Length of Mature Protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
mthl10
Target Protein Sequence
IPFGTYVMAERDHYHTIDDPNVPCNFYDTVNLTGHRLFPNGSYDYYGTIVPAELVGTYDY IHSSLTERIEVREHVRGCVCKFKSCLNICCPWRQVFNSEVDGCIIDHSDNRTWPDPPMLN ITFRNESTILVNMFTQFAIQSFRPCPKMFSLQPETNNWDDYLLFENGSMLRVDDKLLIRK NEFCMVPTYVNESDMFYTIHPANCDMQDDHSTVKIINSYAMMFSIPFMMLTIAVYLLIPE LRNQHGKSLVCYLIGLSVGYSSLCYVQLYQVDATGVTCKVFGYTAYFFFMGAYMWLSVIS FDLWHNFRGTRGINRFQEKKRFLFYSLYSWGIALVFLAFTYCAQQLTNLPANLKPGIGDG VYCWLDMSNWAAMIYFYGPILAIVVANTIMFIMTAIKIHGVQREMARIIASENSTKNLRT EKDKRFYRAWSNYRFGLFLRLFLIMGITWLTELISYFVGSDKGWSKLFYISDLANAMQGF LIFMLFVMKKKVKHLITNRCSSVRDGSNQRQSQYSTKTTSSSVANLSLHEKPSVEKPLVI SSSVDPQKTTIFR
Uniprot No.

Target Background

Database Links

KEGG: dme:Dmel_CG17061

UniGene: Dm.24676

Protein Families
G-protein coupled receptor 2 family, Mth subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mthl10 and what is its evolutionary significance?

Mthl10 is a G-protein coupled receptor (GPCR) that belongs to the Methuselah (Mth) superclade in Drosophila melanogaster. It plays crucial roles in immunological, metabolic, and stress-protective responses. Evolutionarily, Mthl10 emerged from the first gene duplication within the Mth superclade, making it an ancestral member of this family. Unlike Mth, which underwent five further rounds of gene duplication, Mthl10 did not undergo additional expansion in Drosophila . This evolutionary conservation suggests that Mthl10's connection between lifespan and metabolic homeostasis represents an ancestral trait rather than being specific to Mth .

The significance of Mthl10 extends beyond Drosophila models, as many aspects of GPCR signaling are conserved between flies and mammals. There are parallels between Drosophila Growth-Blocking Peptide (GBP) and human defensin BD2, with both being small, cationic cytokines produced by protease action upon larger precursor proteins . This conservation suggests that findings related to Mthl10 may have broader implications for understanding cytokine signaling and aging across species.

How does Mthl10 function as a receptor for Growth-Blocking Peptide (GBP)?

Mthl10 functions as a cell-surface receptor that specifically binds to GBP, a multifunctional cytokine in Drosophila. When GBP binds to Mthl10, it initiates phospholipase C (PLC)/Ca²⁺ signaling cascades . The specific interaction between GBP and Mthl10 has been confirmed through multiple experimental approaches:

  • Fluorophore-tagged GBP (GBP-TMR) binds to S3 cells expressing Mthl10, and this binding is significantly reduced when Mthl10 is knocked down .

  • Using recombinant, purified Mthl10 ectodomain, direct binding with GBP-TMR has been demonstrated through fluorescence polarization assays, with an estimated binding affinity of 6 ± 0.07 μM .

  • Structural modeling, using the crystal structure of Mth as a template, predicts that Mthl10's ectodomain contains a shallow groove that can accommodate GBP binding .

The GBP-Mthl10 binding activates downstream signaling that ultimately regulates various physiological processes, including immune responses, metabolic functions, and stress responses, all of which contribute to the organism's homeostasis but may come at the cost of reduced lifespan .

What is the expression pattern of Mthl10 across different developmental stages and tissues?

Mthl10 exhibits a specific expression pattern across different developmental stages and tissues in Drosophila:

Developmental StageTissues with Mthl10 ExpressionPotential Functions
EmbryosHematopoietic tissue, Crystal cellsImmunological functions, Encapsulation of foreign material
LarvaeImaginal discs, Fat body, CNSOrganogenesis, Nutrient sensing, Immunological functions
AdultsBrain (including ILP2-producing cells), Fat body, HemocytesInsulin-like peptide secretion, Immune responses, Stress adaptation

Particularly noteworthy is the expression of Mthl10 in imaginal discs, suggesting a role in organogenesis . Its expression in hematopoietic tissue and crystal cells correlates with its immunological functions . In adult flies, Mthl10 is co-expressed with insulin-like peptide 2 (ILP2) in specific brain cells, supporting its role in metabolic regulation . The expression in the fat body across different developmental stages underscores its importance in nutrient sensing and immune responses .

What are the optimal methods for recombinant expression and purification of Mthl10?

Based on successful experimental approaches, the following methodology has proven effective for recombinant expression and purification of Mthl10:

Expression System:
E. coli has been successfully used to express recombinant full-length Drosophila melanogaster Mthl10 protein (amino acids 33-585), with an N-terminal His tag .

Protein Specifications:

  • Mature protein sequence (amino acids 33-585)

  • N-terminal His tag for purification

  • Molecular weight approximately 45 kDa (may appear as a smeared band due to glycosylation)

Purification Protocol:

  • Express His-tagged Mthl10 in E. coli

  • Lyse cells and perform initial purification using nickel affinity chromatography

  • Further purify using size exclusion chromatography

  • Confirm purity (>90%) using SDS-PAGE

Storage Recommendations:

  • Lyophilize purified protein

  • Store at -20°C/-80°C

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for long-term storage

  • Avoid repeated freeze-thaw cycles

Buffer Composition:
Tris/PBS-based buffer with 6% Trehalose, pH 8.0

This methodology yields recombinant Mthl10 protein suitable for binding studies, structural analyses, and functional assays.

How can Mthl10 knockdown be effectively achieved in different experimental systems?

Effective Mthl10 knockdown has been achieved in multiple experimental systems using RNA interference (RNAi) approaches. The table below summarizes successful knockdown strategies in different contexts:

Experimental SystemKnockdown MethodVerification ApproachObservable Phenotypes
S3 GCaMP3 cellsdsRNA targeting Mthl10Reduced GBP-mediated Ca²⁺ mobilization (85% reduction)Diminished Ca²⁺ signaling in response to GBP
S2 hemocyte-like cellsdsRNA targeting Mthl10Western blot, qRT-PCRAttenuated ERK-dependent cell spreading, Blocked expression of antimicrobial proteins
Drosophila larvaeTissue-specific RNAiqRT-PCR, ImmunohistochemistryDecreased antimicrobial peptide expression, Altered ILP2 secretion
Adult fliesTransgenic RNAiqRT-PCR, Survival assaysIncreased mortality following bacterial infection, Extended lifespan under normal conditions

For effective knockdown, it is crucial to:

  • Design multiple independent dsRNA constructs targeting different regions of Mthl10 to confirm specificity

  • Include appropriate controls (e.g., scrambled dsRNA)

  • Verify knockdown efficiency using qRT-PCR and/or Western blotting

  • Test for potential off-target effects on related genes (e.g., other members of the Mth superclade)

Importantly, when studying Mthl10 knockdown phenotypes, researchers should be aware that Mthl10 expression varies across tissues, so tissue-specific knockdown approaches may be necessary to dissect its functions in different biological contexts.

What experimental controls should be included when studying GBP-Mthl10 signaling?

Rigorous experimental controls are essential when studying GBP-Mthl10 signaling to ensure reliable and interpretable results:

Controls for Specificity:

  • Scrambled GBP peptide: Use a scrambled version of GBP to confirm specificity of the GBP-Mthl10 interaction

  • Knockdown of other Mth family members: To confirm that observed effects are specific to Mthl10 and not due to functional redundancy within the Mth superclade

  • Knockdown of unrelated GPCRs: For example, Pvr, SR-CIV, or Oamb, to confirm specificity of the observed phenotypes to Mthl10

Controls for Signaling Pathway Integrity:

  • Thapsigargin (TG) treatment: Inhibits Ca-P60A, exposing Ca²⁺ leak from the endoplasmic reticulum and promoting Mthl10-independent, Orai-mediated Ca²⁺ entry into the cell. This control verifies that general Ca²⁺ signaling mechanisms remain intact despite Mthl10 manipulation

  • Expression level controls: Verify that manipulations of Mthl10 do not indirectly affect expression of other pathway components

Controls for Phenotypic Analysis:

  • Off-target effect monitoring: Check expression of related genes (e.g., other Mth superclade members) to ensure they are not affected by Mthl10 knockdown

  • Tissue-specific controls: When studying effects in specific tissues (e.g., brain), include controls to verify that observed phenotypes are not due to changes in other tissues

  • Rescue experiments: Reintroduce wild-type Mthl10 in knockdown backgrounds to confirm that observed phenotypes are directly due to Mthl10 deficiency

Including these controls helps distinguish direct effects of GBP-Mthl10 signaling from indirect or non-specific effects, enhancing the reliability and interpretability of experimental results.

How does the Mthl10/GBP axis integrate immunological, metabolic, and stress responses?

The Mthl10/GBP axis functions as a central integrator of multiple physiological processes, providing a molecular foundation for understanding how stress responses influence lifespan. This integration occurs through several interconnected mechanisms:

Immunological Integration:

  • GBP binding to Mthl10 initiates PLC/Ca²⁺ signaling cascades that activate both cellular and humoral immune responses

  • In hemocyte-like S2 cells, this axis regulates ERK-dependent cell spreading (cellular immunity) and expression of antimicrobial peptides (AMPs) like Metchnikowin (Mtk) and Diptericin (Dpt) (humoral immunity)

  • In adult flies, Mthl10 knockdown dramatically increases mortality rates following bacterial infection, confirming its essential role in immune defense

Metabolic Integration:

  • GBP secreted from the fat body in response to nutrient sensing by Drosophila target of rapamycin (TOR) binds to Mthl10 in insulin-producing cells in the brain

  • This binding promotes the secretion of insulin-like peptides (ILPs), which regulate nutrient utilization

  • Mthl10 knockdown decreases ILP2 secretion, while GBP overexpression promotes it, demonstrating bidirectional control of metabolic signaling

Stress Response Integration:

  • Under low-temperature stress, Mthl10 mediates increased expression of AMPs, linking environmental stress to immune activation

  • Caloric restriction reduces GBP expression, an anti-inflammatory adaptation that is phenocopied by Mthl10 knockdown

  • This integration allows the organism to match nutrient supply to the energetic demands of inflammatory responses

Longevity Trade-off:
The comprehensive integration of these responses through the GBP/Mthl10 axis comes at a cost to organismal longevity:

  • Elevated GBP expression reduces lifespan

  • Conversely, Mthl10 knockdown extends lifespan

This molecular framework provides strong support for the theory that shortened lifespan may be the ultimate price that organisms pay for successful defense against short-term environmental stresses, whether pathogenic or non-infective .

How do experimental findings on Mthl10 contribute to theories of aging and longevity?

Research on the Mthl10/GBP axis provides molecular evidence supporting specific theories of aging and has significant implications for understanding longevity:

Molecular Foundation for Aging Theories:
The Mthl10/GBP system provides direct molecular evidence for the theory that shortened lifespan can be the ultimate price that organisms pay to successfully combat short-term environmental stresses . This supports the antagonistic pleiotropy hypothesis of aging, which suggests that traits beneficial early in life may become detrimental later.

Trade-off Between Stress Responses and Longevity:

  • Elevated GBP expression reduces lifespan, while Mthl10 knockdown extends it

  • This inverse relationship creates a clear molecular pathway connecting successful defense against environmental challenges (both pathogenic and non-infective) to reduced lifespan

Caloric Restriction Mechanisms:
The finding that dietary restriction reduces GBP-mediated antimicrobial peptide expression, a response phenocopied by Mthl10 knockdown , provides a potential molecular mechanism for how caloric restriction extends lifespan—by reducing inflammatory signaling through the GBP/Mthl10 axis.

Comparative Data on Lifespan Effects:

Genetic/Environmental ConditionEffect on Immune ResponseEffect on LifespanProposed Mechanism
GBP overexpressionEnhancedDecreasedElevated inflammatory signaling depletes resources
Mthl10 knockdownReducedExtendedDecreased inflammatory signaling conserves resources
Caloric restrictionReducedExtendedReduced GBP expression decreases inflammatory signaling
Bacterial infection with Mthl10 knockdownSeverely compromisedDrastically reducedInability to mount effective immune response

How can researchers differentiate between direct and indirect effects of Mthl10 manipulation?

Differentiating between direct and indirect effects of Mthl10 manipulation requires careful experimental design and thoughtful data interpretation:

Experimental Strategies:

  • Temporal analysis of signaling events:

    • Measure immediate calcium responses (seconds to minutes) following GBP stimulation with and without Mthl10 knockdown

    • Compare to longer-term effects (hours to days) such as gene expression changes

    • Direct effects typically occur rapidly, while indirect effects emerge over longer timeframes

  • Pathway dissection experiments:

    • Use thapsigargin (TG) to bypass receptor-mediated calcium entry and test if downstream calcium signaling machinery remains intact despite Mthl10 manipulation

    • Selectively inhibit different branches of signaling pathways downstream of Mthl10 to identify which effects depend on which pathways

  • Tissue-specific and inducible knockdown:

    • Employ tissue-specific and temporally controlled Mthl10 knockdown to isolate effects in specific cell types

    • This approach helps distinguish between cell-autonomous effects and secondary consequences of altered intercellular signaling

Analytical Approaches:

  • Gene expression profiling:

    • Compare transcriptional changes following acute versus chronic Mthl10 manipulation

    • Identify immediate response genes (direct targets) versus delayed response genes (indirect targets)

    • Analyze promoter regions of affected genes for common regulatory elements that might indicate direct regulation

  • Network analysis:

    • Construct signaling networks based on experimental data to identify nodes that directly connect to Mthl10

    • Map observed phenotypes to specific branches of the network to identify proximal versus distal effects

  • Rescue experiments:

    • Perform targeted rescue of specific downstream pathways in Mthl10 knockdown backgrounds

    • If rescuing a single pathway reverses a particular phenotype, that phenotype is likely a direct consequence of that pathway's dysregulation

By combining these approaches, researchers can build a hierarchical model of Mthl10-dependent processes, distinguishing primary effects from secondary consequences and identifying the key molecular mechanisms through which Mthl10 influences organismal physiology and lifespan.

What analytical frameworks help resolve contradictions in studies of Mthl10's pleiotropic functions?

Mthl10's involvement in multiple physiological processes creates challenges in interpreting seemingly contradictory experimental results. The following analytical frameworks can help resolve such contradictions:

Context-Dependent Analysis:

  • Recognize that Mthl10's effects may differ based on developmental stage, tissue type, physiological state, and environmental conditions

  • Systematically document the specific experimental contexts in which observations were made

  • Create a matrix mapping different Mthl10 functions to specific contexts to identify patterns and potential explanations for contradictory findings

Quantitative Dose-Response Relationships:

  • Consider that different Mthl10-dependent processes may have different thresholds of activation or inhibition

  • Perform dose-response experiments with varying levels of Mthl10 expression/knockdown and GBP stimulation

  • Map different physiological outcomes against receptor activity levels to identify potential biphasic responses

Temporal Resolution:

  • Establish detailed timelines of Mthl10-dependent events following GBP stimulation

  • Different processes may occur with different kinetics, creating apparent contradictions when measured at single time points

  • Time-course experiments can reveal how different effects emerge, peak, and resolve over time

Interaction Network Analysis:

  • Construct comprehensive interaction networks including Mthl10, GBP, and their downstream effectors

  • Identify feedback loops, crosstalk with other pathways, and compensatory mechanisms that may explain contextual differences in Mthl10 function

  • Use computational modeling to predict how perturbations in different parts of the network might lead to apparently contradictory outcomes

Evolutionary Perspective:

  • Consider that seemingly contradictory functions may reflect evolutionary trade-offs

  • The antagonistic relationship between stress responses and longevity mediated by Mthl10 exemplifies how a single pathway can have opposing effects on different fitness components

  • This perspective can transform apparent contradictions into mechanistically coherent examples of life-history trade-offs

By applying these frameworks, researchers can develop more nuanced interpretations of experimental data, recognizing that apparent contradictions often reflect the complex, context-dependent nature of Mthl10's role as an integrator of multiple physiological processes rather than actual inconsistencies in the underlying biology.

What are promising approaches for translating Mthl10 research to human aging and disease?

While Mthl10 itself is specific to Drosophila, the signaling pathways and biological principles revealed through its study have significant translational potential for human aging and disease research:

Comparative Receptor Biology:

  • Identify human GPCRs with functional similarities to Mthl10, focusing on receptors that integrate stress responses, metabolism, and inflammation

  • GBP exhibits sequence similarity with human defensin BD2, and both initiate PLC/Ca²⁺ signaling

  • Investigate whether human BD2 receptors mediate similar trade-offs between immune function and longevity

Shared Signaling Mechanisms:

  • Focus on conserved downstream signaling components, such as PLC/Ca²⁺ pathways, which are highly conserved between flies and mammals

  • Develop interventions targeting these conserved components to potentially modulate aging processes across species

Therapeutic Target Identification:

  • Screen for compounds that modulate GBP-Mthl10 binding or downstream signaling in Drosophila

  • Test whether these compounds also affect similar pathways in mammalian systems

  • Prioritize targets at the intersection of immune function, metabolism, and stress responses

Biomarker Development:

  • Identify molecular signatures associated with Mthl10 activation/inhibition that correlate with longevity in Drosophila

  • Test whether analogous signatures exist in mammals and whether they predict health span or lifespan

Genomic Approaches:

  • Conduct comparative genomic analyses to identify human genetic variants in pathways analogous to the GBP/Mthl10 axis

  • Investigate associations between these variants and human longevity, stress resilience, or inflammatory disorders

Experimental Testing Framework:

Translational ApproachDrosophila ResearchHuman ApplicationPotential Impact
Pathway conservationMap GBP/Mthl10 signaling componentsIdentify human orthologsTarget identification for anti-aging interventions
Phenotypic translationCharacterize Mthl10 effects on lifespanTest orthologous pathways in human cells and tissuesDevelopment of biomarkers for aging
Pharmacological modulationScreen for GBP/Mthl10 modulatorsTest effects on human cellular stress responsesNovel therapeutics for inflammatory diseases
Genetic associationIdentify genetic modifiers of Mthl10 functionLook for human variants in orthologous genesPersonalized approaches to healthy aging

By leveraging the fundamental principles revealed through Mthl10 research—particularly the molecular basis for trade-offs between immune function and longevity—researchers can develop novel approaches to addressing age-related diseases and promoting healthy aging in humans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.