Recombinant Drosophila melanogaster Probable G-protein coupled receptor Mth-like 12 (mthl12)

Shipped with Ice Packs
In Stock

Description

Introduction to Mthl12

Mthl12 (Methuselah-like 12) is a member of the Methuselah (Mth) family of G-protein coupled receptors found in Drosophila melanogaster, commonly known as the fruit fly . The broader Methuselah family has garnered significant scientific attention due to its associations with longevity and stress resistance mechanisms in Drosophila . While considerable research has focused on the canonical Methuselah (mth) gene, the related Methuselah-like genes, including mthl12, represent an important area for investigating the functional diversity within this gene family.

The mthl12 protein is officially classified as a "Probable G-protein coupled receptor Mth-like 12," indicating its predicted function and structural similarity to other G-protein coupled receptors within the Methuselah family . In database entries, it is also referred to by synonyms including "Mth-like-12," "CG32853," and "Protein methuselah-like 12" .

Physical and Biochemical Properties

The recombinant mthl12 protein exhibits specific characteristics that define its structure and potential function. As commercially available for research purposes, the protein presents the following properties:

PropertyDescription
Source OrganismDrosophila melanogaster (Fruit fly)
Expression SystemE. coli
TagHistidine
Protein LengthFull Length of Mature Protein (amino acids 18-488)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ApplicationsSDS-PAGE
Storage Recommendations-20°C/-80°C; avoid repeated freeze-thaw cycles

For optimal preservation, it is recommended to briefly centrifuge the vial prior to opening and to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol addition for long-term storage .

Phylogenetic Origins

Detailed phylogenetic, synteny, protein structure, and gene expression analyses have identified orthologous genes to mth in distantly related species. For example, the D. virilis GJ12490 gene has been identified as orthologous to mth in species far removed from D. melanogaster on the evolutionary tree . This finding suggests a much older evolutionary origin for the Methuselah family than previously thought.

Evolutionary Dynamics

The Mth/Mthl gene family appears to have experienced numerous extinction and expansion events throughout metazoan evolution . This dynamic pattern of gene gain and loss has contributed to the diversity observed within the Methuselah family across different species and likely explains the presence of multiple Methuselah-like genes, including mthl12, in Drosophila melanogaster.

Research suggests that despite this evolutionary flexibility, the functional importance of these genes has been maintained, as evidenced by their specific expression patterns and physiological effects. In Drosophila melanogaster specifically, the Methuselah family has expanded to include 16 members, with mthl12 being one of these functionally significant paralogs .

Physiological Roles

While specific functions of mthl12 are not extensively documented in the available research, insights can be drawn from studies of the broader Methuselah family. The canonical Methuselah protein and related family members have been implicated in several significant physiological processes:

  1. Regulation of lifespan and aging processes

  2. Stress resistance mechanisms

  3. Larval development

  4. Adult size determination

Research has demonstrated that mutations in the mth gene can lead to increased lifespan and enhanced resistance to various stressors in Drosophila melanogaster . Additionally, a common amino acid polymorphism at the GJ12490 orthologous gene (related to mth) has been significantly associated with developmental time, size, and lifespan differences in D. americana . These findings suggest potential similar roles for mthl12, though specific studies confirming these functions for this particular family member are needed.

Signaling Mechanisms

As a G-protein coupled receptor, mthl12 likely functions by binding specific ligands that trigger intracellular signaling cascades. Studies of the canonical Methuselah protein have identified several peptide agonists, including Stunted (Sun), Drosophila Sex Peptide (SP), and a novel peptide called Serendipitous Peptide Activator of Mth (SPAM) .

Interestingly, these peptide agonists share little sequence homology, demonstrating the promiscuity of Mth for activation by diverse ligands . This suggests that mthl12 may also interact with multiple ligand types, though the specific molecules that activate this receptor remain to be identified.

It should be noted that there are challenges in translating in vitro findings to in vivo relevance. For instance, mth mutants exhibit no defects in behaviors controlled by Sex Peptide, despite this peptide activating Mth in laboratory conditions . This highlights the complexity of receptor-ligand interactions in physiological contexts.

Experimental Utility

Recombinant mthl12 protein serves as a valuable tool for various scientific investigations:

  1. Structural biology studies to determine the three-dimensional configuration of the protein

  2. Identification of potential ligands that specifically interact with mthl12

  3. Comparative analyses with other Methuselah family members to understand functional diversification

  4. Development of targeted interventions that might modulate aging or stress resistance pathways

The availability of highly purified recombinant protein facilitates these investigations by providing consistent material for experimental procedures such as binding assays, structural analyses, and functional studies .

Future Research Directions

Given the current state of knowledge about mthl12 and the broader Methuselah family, several promising directions for future research emerge:

  1. Specific functional characterization of mthl12 through knockout or overexpression studies

  2. Identification of natural ligands that bind to and activate mthl12

  3. Structural analyses to determine the three-dimensional configuration of the protein

  4. Comparative studies with other Methuselah family members to understand functional diversification

  5. Investigation of potential applications in aging research and stress resistance pathways

Advances in these areas would significantly enhance our understanding of mthl12's biological significance and potentially reveal new insights into the mechanisms of aging and stress resistance in Drosophila and possibly other organisms.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your specific requirements.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mthl12; Mth-like-12; CG32853; Probable G-protein coupled receptor Mth-like 12; Protein methuselah-like 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-488
Protein Length
Full Length of Mature Protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
mthl12
Target Protein Sequence
KNSSAKIPHCKYDETINISHFKRLNDAYIYEHFEIPANLTGEFDYKELMDGSKVPTEFPN LRGCICKVRPCIRICCARKNILSNGECSDGVKNEIKLTMLDLTMQDILLTDPTLAELNMI PQYNSTELLILREQFQPCDEIVSLKRDEYTILKDGSILLHTSAEILSNDQYCLYPEIYSD FPETIRIINRRCYRNVMPGIAQLSVISVVGFILTLAVYLSVEKLRNLLGKCLICSLFSMF MEYFIWTMDYFRLLQSICSAAGYMKYFFSMSSYLWFSVVSFHLWELFTSLNRHEPQYRFL IYNTFVWCTAAIPTVVIFSMNQMWENDPGKSEWLPLVGYFGCSVKDWNSSSWFYSHIPIV ILNSFNVIMFVLTAIYIWKVKKGVKSFAQHDERNTTCLEFNVQTYIQFVRLFLIMGASWL LDQLTRLAEDSHLLLDTIVLNLTVYLNAAFGILIFVLLILKGSTFKMIMER
Uniprot No.

Target Background

Database Links

KEGG: dme:Dmel_CG32853

STRING: 7227.FBpp0082214

UniGene: Dm.26413

Protein Families
G-protein coupled receptor 2 family, Mth subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is mthl12 and how does it relate to the methuselah gene family?

Mthl12 (methuselah-like 12) is one of 16 members of the methuselah gene subfamily of G-protein coupled receptors (GPCRs) in Drosophila melanogaster. The methuselah gene family is characterized by specific expression patterns in embryos, larvae, and adults, with various members implicated in larval development, stress resistance, and lifespan regulation. Unlike what was previously thought about the methuselah gene being relatively recent (less than 10 million years old), phylogenetic analyses have revealed that methuselah and its related genes, including mthl12, are evolutionarily conserved across Drosophila species, suggesting significant functional importance . The methuselah family shows structural characteristics typical of class B GPCRs, with a large N-terminal extracellular domain and seven transmembrane regions.

What are the expression patterns of mthl12 in different developmental stages?

The expression of mthl12, like other methuselah family members, varies across developmental stages. Based on studies of the methuselah gene, which serves as a model for understanding mthl12, these genes show highly specific expression patterns in embryos, larvae, and adults . In particular, expression analysis techniques such as in situ hybridization and reporter gene assays have revealed that methuselah family genes are often expressed in neural tissues, fat bodies, and other specific cell types involved in development and stress response. For mthl12 specifically, researchers should employ RT-PCR, RNA-seq, or in situ hybridization techniques to characterize expression patterns across tissues and developmental stages, comparing results with the well-characterized expression patterns of the founding methuselah gene.

What are the optimal expression systems for producing recombinant mthl12 protein?

For recombinant expression of Drosophila melanogaster mthl12, Drosophila S2 cell expression systems offer significant advantages due to proper post-translational modifications and protein folding. The FAS2FURIOUS expression pipeline represents an optimized approach for secreted expression in S2 cells. This system allows for moderate-throughput expression with several key advantages over bacterial systems when expressing eukaryotic membrane proteins like mthl12 .

For mthl12 expression, researchers should consider the following protocol:

  • Clone the mthl12 coding sequence into a pExpreS2 vector system

  • Transfect Drosophila S2 cells using reduced volumes (3 ml per construct) in 24-well deep-well blocks

  • Use approximately 7.5 μg DNA at >200 ng/μl concentration, obtainable from standard miniprep

  • Implement selection using appropriate antibiotics (2 mg/ml Zeocin for pExpreS2-1 vectors or 4 mg/ml G418 for pExpreS2-2 vectors)

  • Scale up successful transfections to larger culture volumes

This approach allows testing of multiple constructs in parallel and takes approximately 2 weeks for the cloning and test expression stages, making it significantly faster than many alternative eukaryotic expression systems .

What purification strategies are most effective for recombinant mthl12?

For purification of recombinant mthl12, a membrane-bound GPCR, researchers should implement a multi-step purification strategy:

  • Membrane extraction using detergents suitable for GPCRs (e.g., DDM, LMNG)

  • Affinity chromatography utilizing epitope tags (His, FLAG, or Strep tags)

  • Size exclusion chromatography to achieve high purity

For high-throughput initial screening, a 96-well filter-plate-based test purification protocol can be employed to rapidly analyze expression levels before scaling up . When scaling to larger preparations, consider using specialized Drosophila expression systems like the ExpreS²ion platform, which can achieve high cell densities (>1 × 10⁶ cells/ml) in shake flask cultures, enhancing protein yield. For functional studies, maintaining the native conformation of mthl12 during purification is critical, often requiring stabilization with appropriate ligands or nanobodies during the purification process.

How conserved is mthl12 across Drosophila species and what does this suggest about its function?

Contrary to earlier assumptions about methuselah family genes being evolutionarily recent, detailed phylogenetic, synteny, and protein structure analyses have revealed significant conservation across Drosophila species. Research on the methuselah gene has shown that orthologous genes exist in species distantly related to D. melanogaster, such as the D. virilis GJ12490 gene . This conservation pattern likely extends to mthl12, suggesting fundamental biological importance.

Researchers investigating mthl12 conservation should perform:

  • Multiple sequence alignments across Drosophila species

  • Synteny analysis to identify orthologous relationships

  • Protein structure prediction and comparison

  • Functional complementation studies to test functional conservation

The high degree of conservation observed in methuselah family genes correlates with their significant roles in development, stress resistance, and lifespan determination. In D. americana, common amino acid polymorphisms in methuselah orthologs are significantly associated with developmental time, size, and lifespan differences , suggesting that similar functional significance may exist for mthl12 variants across species.

What is the relationship between mthl12 and other methuselah family members in terms of receptor function?

While mthl12 belongs to a gene subfamily with 16 members in D. melanogaster, functional redundancy among these family members appears limited . Researchers investigating the functional relationships between mthl12 and other methuselah family proteins should consider:

  • Ligand binding profiling to identify shared or distinct ligand preferences

  • Signaling pathway analysis through G-protein coupling assays

  • Expression pattern comparisons to identify potential functional overlap

  • Phenotypic analysis of single and combined knockout/knockdown models

The methuselah gene itself has been implicated in multiple physiological processes including larval development, stress resistance, and lifespan regulation . Similar multifaceted roles may exist for mthl12, with potentially specialized functions that complement or interact with other family members. Cross-rescue experiments, where mthl12 is expressed in mutants of other methuselah family genes and vice versa, can help elucidate functional relationships within this receptor family.

What CRISPR-based strategies are most effective for studying mthl12 function in vivo?

CRISPR/Cas9 technology offers powerful approaches for functional characterization of mthl12 in Drosophila. Based on genome editing approaches used in other Drosophila studies, researchers should consider:

  • Complete gene knockout through targeted deletions

  • Point mutations to study specific amino acid residues critical for function

  • Knock-in of reporter tags (GFP, RFP) for visualizing expression patterns

  • Conditional knockout systems for tissue-specific or temporal control

For effective CRISPR design targeting mthl12:

  • Select guide RNAs with minimal off-target effects

  • Design homology-directed repair templates for precise modifications

  • Implement efficient screening strategies for identifying successful edits

  • Consider using the Gal4-UAS system in combination with CRISPR for tissue-specific studies

When analyzing phenotypes, researchers should examine multiple aspects including developmental timing, stress resistance, lifespan, and behavioral parameters, as methuselah family genes have been implicated in these diverse processes .

How can researchers effectively measure mthl12 signaling activity in cellular assays?

For measuring the signaling activity of mthl12, researchers should implement multiple complementary approaches:

  • G-protein coupling assays (BRET or FRET-based)

  • Second messenger (cAMP, Ca²⁺, IP₃) quantification

  • Downstream kinase activation measurement (ERK, AKT, etc.)

  • Transcriptional reporter assays for pathway-specific responses

Each of these approaches provides different insights into receptor function:

Assay TypeMeasured ParameterTechnical ApproachAdvantagesLimitations
G-protein couplingDirect interaction with G proteinsBRET/FRET biosensorsImmediate receptor activation detectionRequires protein engineering
Second messengerDownstream signaling moleculesELISA, fluorescent indicatorsAmplified signal, commercially available kitsPathway convergence can complicate interpretation
Kinase activationPhosphorylation of downstream targetsWestern blot, TR-FRETIntegrates multiple upstream signalsTemporal resolution limitations
Transcriptional reportersGene expression changesLuciferase assays, qPCREndpoint functional outcomesDelayed response, multiple regulatory inputs

These assays should be performed in appropriate cellular contexts, ideally in Drosophila S2 cells which provide a native-like environment for mthl12 function . Key challenges include identifying physiological ligands for mthl12, as the natural agonists for many methuselah family receptors remain unknown.

How does mthl12 contribute to stress resistance mechanisms in Drosophila?

The methuselah gene has been implicated in stress resistance mechanisms in Drosophila , and mthl12 may play similar or complementary roles. To investigate mthl12's contribution to stress resistance:

  • Generate mthl12 knockout or knockdown flies

  • Subject flies to various stressors (oxidative, heat, starvation)

  • Measure survival rates, behavioral responses, and physiological parameters

  • Analyze gene expression changes under stress conditions with and without functional mthl12

  • Compare with other methuselah family knockouts to identify unique and shared contributions

Researchers should pay particular attention to potential compensatory mechanisms within the methuselah family, as the 16 members may have partially redundant functions . A comprehensive analysis would include examination of double or triple knockouts of closely related family members. Additionally, tissue-specific knockdown using the GAL4-UAS system can help identify the cellular contexts in which mthl12 contributes most significantly to stress resistance.

What role does mthl12 play in Drosophila aging and lifespan determination?

Given the established role of the methuselah gene in lifespan regulation , investigating mthl12's contribution to aging processes represents an important research direction. Approaches should include:

  • Lifespan analysis of mthl12 mutant flies under various environmental conditions

  • Assessment of age-related physiological parameters (metabolic rate, locomotor activity)

  • Investigation of interactions with established longevity pathways (insulin/IGF, TOR, FOXO)

  • Analysis of tissue-specific aging phenotypes through conditional mthl12 manipulation

In D. americana, amino acid polymorphisms in methuselah orthologs are associated with developmental time, size, and lifespan differences , suggesting that genetic variation in mthl12 may similarly impact aging phenotypes. Researchers should consider natural variation studies in addition to knockout approaches to fully characterize mthl12's role in aging processes.

How can researchers overcome difficulties in identifying physiological ligands for mthl12?

Identifying natural ligands for orphan GPCRs like mthl12 represents a significant challenge. Based on approaches used for other GPCRs, researchers should consider:

  • Unbiased screening approaches:

    • Tissue extract fractionation and testing

    • Peptide/small molecule library screening

    • Reverse pharmacology approaches using transcriptional readouts

  • Candidate-based approaches:

    • Testing compounds known to activate related receptors

    • Computational prediction based on receptor structure

    • Evolutionary analysis to identify conserved ligand-receptor pairs

  • Methodological approaches:

    • Implementing sensitive assays (e.g., impedance-based, label-free)

    • Using receptor overexpression systems to amplify responses

    • Employing chimeric G-proteins to channel signaling to measurable pathways

Once candidate ligands are identified, researchers should validate physiological relevance through genetic approaches, examining whether disruption of ligand production phenocopies receptor knockout effects.

What are the best approaches for resolving the 3D structure of mthl12?

Determining the three-dimensional structure of membrane proteins like mthl12 presents significant technical challenges. Researchers should consider multiple complementary approaches:

  • X-ray crystallography:

    • Requires detergent solubilization and stabilization

    • Often employs fusion proteins (T4 lysozyme, BRIL) for crystallization

    • May benefit from antibody fragments or nanobodies to stabilize specific conformations

  • Cryo-electron microscopy:

    • Increasingly powerful for membrane protein structure determination

    • Can be performed in lipid nanodiscs for more native-like environment

    • May require receptor stabilization and homogeneity optimization

  • Computational modeling:

    • Homology modeling based on related GPCRs with solved structures

    • Molecular dynamics simulations to study conformational dynamics

    • Integration with experimental constraints from mutagenesis or spectroscopy

For expression of mthl12 for structural studies, the Drosophila S2 expression system offers advantages for proper folding and post-translational modifications . Structure determination should aim to capture multiple functional states (inactive, active, ligand-bound) to fully understand receptor dynamics and signaling mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.