Recombinant Drosophila melanogaster Probable G-protein coupled receptor Mth-like 1 (mthl1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Drosophila melanogaster

mthl1 regulates critical biological processes:

  • Antitumor Defense: Injection of oncogenic cells (OCs) into flies induces mthl1 expression, which suppresses OC proliferation via chemoreceptor cascades and repression of developmental pathways (dpp, hh, wg) .

  • Innate Immunity: Unlike responses to bacteria or viruses, mthl1 activation is specific to tumor cells, suggesting a targeted defense mechanism .

  • Longevity: Loss-of-function (LOF) mutations in mthl1 extend lifespan by ~8 days, linking it to stress resistance .

Interaction Partners and Signaling Pathways

mthl1 interacts with:

PartnerRoleInteraction Score
ctaGuanine nucleotide-binding protein alpha subunit; mediates RhoGEF2 signaling0.684
smogGPCR involved in gastrulation and myosin II activation0.604
krzArrestin regulating receptor desensitization0.504
mthl14Related GPCR with overlapping ligand specificity0.838

These interactions highlight mthl1’s role in cytoskeletal remodeling and signal transduction .

4.1. Antiproliferative Activity

  • LOF Mutants: mthl1 LOF flies exhibit accelerated OC proliferation post-injection .

  • Overexpression: Suppresses OC growth by downregulating developmental genes (dpp, wg) .

  • Mechanism: mthl1 activates chemoreceptors (e.g., Or83b) and inhibits Notch and Wnt pathways .

4.2. Evolutionary Conservation

  • Mammalian Homolog: Mouse Adgre1 (F4/80), a macrophage marker, is upregulated in response to melanoma cells, paralleling mthl1’s role .

  • Phylogeny: The mthl gene family is ancient, with orthologs in D. virilis and other Diptera .

Applications and Implications

  • Cancer Research: mthl1’s tumor-suppressive effects in flies provide a model for studying GPCR-mediated antitumor immunity .

  • Drug Development: Targeting mthl1-like receptors (e.g., Adgre1) could modulate myeloid cell responses in mammals .

  • Aging Studies: mthl1 LOF mutants offer insights into longevity pathways .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mthl1; CG4521; Probable G-protein coupled receptor Mth-like 1; Protein methuselah-like 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
38-676
Protein Length
Full Length of Mature Protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
mthl1
Target Protein Sequence
IEEMSPPPAAPPRPSPPPTVKLNKCCHSGEYLNDGTCIAGSEALWLPMVYLVQQQRFFEP HGASPRFLKFLPNTRPTCRKDQTTEIFRSRGANVMLFPNGTLYVRERALMVQPSDYCVDW EVAVVCLNDSQPINALEDPDYAANPLVQQEPPKASLRLSKCCGKWGSYNTQLQNCDLQPN HQAAVDGLLRLSPQLPEGSYQTSYGLPDCGQPGGYSIAGDWQDAKLDRNTAMLQLPHKNL SAGQYCLEHTQREGEVKIIACQHLFSSAAGAGIHDGSIGGTIEQANGQNLQKAVLTGGIL VSIVFLSATLVAGFLLPAVHHALHWRCQICYVTCLLFGKILLAIEELSSSLQPGSAACHT LAITMQFFFLAAFFWLNTMCFNIWWTFRDFRPSSLERNQEALRRYLYSLYAWGGPLLITF VAACVDQLPETTLLRPGFGQLYCWFDNRNLSIFAYFYGPIGLLLCANIALFVSTTHQLTC GLWKRDDVKSSSEKSALGRVCLKLVVVMGVTWIADILSWLVGGPHGVWFFTDLINALQGV FIFIVVGCQPQVWTACRRIFCPRLRHDITNTTNGVQHSSSSQGLPSMAGGTEITQNTTTT TTTTNTTATHMPSNPAEDEVPEKAPIAPVAPIVKMETIC
Uniprot No.

Target Background

Database Links

KEGG: dme:Dmel_CG4521

STRING: 7227.FBpp0074089

UniGene: Dm.13459

Protein Families
G-protein coupled receptor 2 family, Mth subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

Q1: What are the optimal systems for expressing recombinant Mthl1, and how do they compare in yield and post-translational modification?

Q2: What is the functional role of Mthl1 in Drosophila tumor defense, and how is it activated?

Mthl1 is transcriptionally induced in adult male flies after injection of oncogenic cells (OCs) but not embryonic cells or microbes . It exerts an antiproliferative effect on OCs, with mthl1 knockdown (KD) accelerating tumor growth and overexpression suppressing it . The mechanism involves regulating chemoreceptors and developmental genes, potentially modulating immune surveillance or metabolic pathways. Notably, Mthl1’s mammalian homolog Adgre1 (F4/80) shows similar upregulation in myeloid-rich tissues (bone marrow, spleen) post-tumor cell inoculation in mice, suggesting conserved roles in innate antitumor responses .

Advanced Research Questions

Q3: How can researchers design experiments to disentangle Mthl1’s direct antiproliferative effects from indirect immune-mediated mechanisms?

To isolate Mthl1’s direct effects, use mthl1 KD or overexpression in Drosophila mutants lacking immune cells (e.g., hemese mutants). Compare OC proliferation in these backgrounds to identify immune-independent roles. For indirect effects, profile chemokine/cytokine expression (e.g., via RNA-seq) in mthl1-manipulated hosts to map downstream signaling pathways .

Q4: What methodological challenges exist in validating Mthl1 as a homolog of mammalian Adgre1, and how can they be addressed?

Key challenges include divergent tissue expression (Mthl1 in Drosophila fat body vs. Adgre1 in mammalian myeloid cells) and functional differences in receptor activation. Address these by:

  • Cross-species transcriptomic profiling: Compare gene co-expression networks (e.g., chemokine receptors, developmental regulators) induced by tumor cells in Drosophila (Mthl1) and mice (Adgre1).

  • Functional assays: Test whether Adgre1 knockdown in mice recapitulates the tumor-promoting phenotype of mthl1 KD in flies.

  • Structural homology: Use cryo-EM to compare Mthl1 and Adgre1’s extracellular domains for conserved ligand-binding motifs.

Q5: How can researchers resolve discrepancies in Mthl1’s expression patterns across studies?

Discrepancies often arise from differences in injection models (e.g., OC vs. microbial pathogens). To clarify, standardize experimental conditions:

  • Stimuli: Use RasV12-expressing oncogenic cells for tumor-specific induction .

  • Timing: Measure Mthl1 expression at 3–5 days post-injection, as OC proliferation peaks later .

  • Tissue specificity: Profile Mthl1 in fat body (immune/metabolic hub) vs. hemocytes (immune cells) using FISH or cell-type-specific reporters.

Experimental Design and Data Analysis

Q6: What are the limitations of using Drosophila for studying Mthl1’s role in human cancer, and how can they be mitigated?

Limitations include the absence of adaptive immunity and differences in tumor microenvironments. Mitigate by:

  • Comparative models: Validate findings in Drosophila using mammalian systems (e.g., CRISPR-edited Adgre1 knockout mice).

  • Xenograft assays: Inject human tumor cells into Drosophila to assess Mthl1’s cross-species relevance.

  • RNAi screens: Identify conserved downstream targets (e.g., chemokines) that could be prioritized in human studies.

Q7: How can researchers quantify Mthl1’s impact on tumor growth kinetics in Drosophila?

Use high-resolution live imaging to track OC proliferation in real time. Pair with:

  • Genetic tools: mthl1 KD or overexpression under UAS control, driven by tissue-specific Gal4 lines (e.g., fat body or hemocyte drivers).

  • Quantitative metrics: Measure tumor area, cell cycle markers (e.g., Phospho-Histone H3), or apoptosis markers (e.g., caspase activation).

Methodological Insights

Q8: What computational tools can predict Mthl1’s structural stability and interaction motifs?

Use:

  • Rosetta: For ΔΔG calculations to predict thermodynamic stability of Mthl1 variants .

  • GEMME: To assess evolutionary conservation and mutational tolerance in the receptor’s extracellular domain .

  • Yeast two-hybrid (Y2H): To screen for interactions with potential ligands or signaling partners (e.g., Gα subunits).

Q9: How does Mthl1’s regulation of chemoreceptors and developmental genes contribute to tumor suppression?

Mthl1 may modulate:

  • Chemokine gradients: Directing immune cells to tumor sites.

  • Metabolic pathways: Limiting nutrient availability for OCs.

  • Apoptosis: Upregulating pro-apoptotic factors (e.g., reaper) in OCs.
    Validate these pathways via RNAi or CRISPR interference (CRISPRi) targeting Mthl1-regulated genes.

Comparative Biology and Evolution

Q10: What evidence supports Mthl1 as a functional homolog of mammalian Adgre1?

Key evidence includes:

  • Expression kinetics: Both are induced 3 days post-tumor cell injection, peaking in immune-competent tissues (Drosophila fat body vs. mammalian bone marrow/spleen) .

  • Phylogenetic conservation: Shared domain architecture (GPCR family) and synteny in genomic loci.

  • Functional parallels: Antiproliferative effects in Drosophila and potential roles in myeloid cell activation in mammals.

Data Tables

Table 1: Expression Levels of Recombinant GPCRs in Drosophila Photoreceptor Cells

ReceptorOrganismExpression Level (pmol/mg)
CCR5H. sapiens555
DmGluRAD. melanogaster226
mGluR5R. norvegicus192
Rh1D. melanogaster502
V2RH. sapiens>1000
Data sourced from Panneels et al. (2011) .

Table 2: Mthl1 and Adgre1 Induction in Tumor Models

ModelMthl1/Adgre1 InductionKey Observations
Drosophila + OCsMthl1 ↑ 3 days post-injectionAntiproliferative effect on OCs .
Mouse + B16-F10 cellsAdgre1 ↑ in BM/spleenMyeloid cell activation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.