Recombinant Drosophila melanogaster Probable gustatory receptor 64e (Gr64e)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Drosophila melanogaster Probable Gustatory Receptor 64e (Gr64e) is a genetically engineered protein derived from the Gr64e gene, a member of the insect gustatory receptor (GR) family. Gr64e plays dual roles in Drosophila taste perception, functioning as a ligand-gated ion channel for glycerol detection and as a downstream effector in phospholipase C (PLC)-mediated fatty acid (FA) sensing . Its recombinant form enables biochemical and functional studies to dissect its molecular mechanisms across diverse contexts.

Role in Taste Perception

FunctionMechanismKey Evidence
Glycerol DetectionDirect ion channel activationGr64e mutants show reduced proboscis extension reflex (PER) to glycerol .
Fatty Acid DetectionPLC-dependent signaling pathwayGr64e rescue experiments restore FA responses in norpA (PLC) mutants .
Context-Dependent ActionInterchangeable with TRPA1 in PLC-mediated pathways but not direct channelsTRPA1 substitutes for Gr64e in FA sensing; Gr64e rescues TRPA1 mutants .

Non-Neuronal Roles

Gr64e contributes to cellular proteostasis in epithelial cells under proteotoxic stress (e.g., ribosome protein haploinsufficiency) . Loss of Gr64e exacerbates protein aggregation and impairs autophagy/proteasome function .

Applications in Research

  • Signal Transduction Studies: Used to elucidate PLC-dependent vs. ligand-gated ion channel mechanisms .

  • Structural Biology: Recombinant Gr64e enables crystallization and topology mapping efforts .

  • Disease Models: Investigates proteostasis dysfunction in neurodegenerative contexts .

Technical Considerations for Use

  • Reconstitution: Lyophilized protein requires careful resuspension in glycerol-containing buffers to prevent aggregation .

  • Functional Assays: Electrophysiological (e.g., tip recordings) and behavioral (e.g., PER) tests validate activity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Gr64e; CG14988; Gustatory receptor for sugar taste 64e
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-451
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr64e
Target Protein Sequence
MARTTGDPAKRRRCMSRIKFWRRSRVGSEVVEKDTKRFKLSLIKAWLLRIRQEDYKYSGS FQEAIKPVLIIAQIFALMPVRKVSSKFAEDLTFTWFSVRSYYALVTILFFGVSSGYMVAF VTSVSFNFDSVETLVFYLSIFLISLSFFQLARKWPEIAQSWQLVEAKLPPLKLPKERRSL AQHINMITIVATTCSLVEHIMSMLSMGYYVNSCPRWPDRPIDSFLYLSFSSVFYFVDYTR FLGIVGKVVNVLSTFAWNFNDIFVMAVSVALAARFRQLNDYMMREARLPTTVDYWMQCRI NFRNLCKLCEEVDDAISTITLLCFSNNLYFICGKILKSMQAKPSIWHALYFWFSLVYLLG RTLILSLYSSSINDESKRPLVIFRLVPREYWCDELKRFSEEVQMDNVALTGMKFFRLTRG VVISVAGTIVTYELILLQFNGEEKVPGCFEN
Uniprot No.

Target Background

Function
One of the few identified sugar gustatory receptors, Gr64e promotes an increase in feeding motivation during starvation. It confers responsiveness to glycerol and is crucial for the preference towards beer and other sources containing fermenting yeast.
Gene References Into Functions
  1. TRPA1 can substitute for GR64e in Fatty Acids (FA) but not glycerol sensing, and GR64e can substitute for TRPA1 in aristolochic acid but not N-methylmaleimide sensing. In contrast to its role in FA sensing, GR64e functions as a ligand-gated ion channel for glycerol detection. PMID: 29420533
  2. This study provides insights into the molecular mechanisms underlying the acceptance of yeast products and suggests that Gr64e contributes to specific evolutionary variations in appetitive selectivity across Drosophila species. PMID: 22057190
Database Links

KEGG: dme:Dmel_CG32258

STRING: 7227.FBpp0099916

UniGene: Dm.21292

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr5a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in Gr5a-expressing sugar-sensing cells.

Q&A

What is the Gr64 cluster and what role does Gr64e play within this gene family?

The Gr64 cluster consists of 6 tandem gustatory receptor genes (Gr64a through Gr64f) involved in mediating sensation of sugars, fatty acids, and glycerol in the Drosophila melanogaster nervous system . These genes are arranged in a polycistronic locus, with coordinated expression patterns . Within this cluster, Gr64e has emerged as a multifunctional receptor with distinct molecular mechanisms depending on the context. Research has demonstrated that Gr64e specifically mediates glycerol sensation by functioning as a ligand-gated ion channel, while also participating in fatty acid sensing through interaction with the phospholipase C (PLC) signaling pathway . Recent studies have further revealed unexpected non-neuronal functions of Gr64e in maintaining proteostasis in epithelial cells under proteotoxic stress conditions .

What experimental techniques are most effective for studying Gr64e function in vivo?

Several complementary techniques have proven valuable for investigating Gr64e function:

  • Behavioral Assays: Proboscis Extension Reflex (PER) assays provide quantitative measurements of gustatory responses to various compounds including glycerol and fatty acids .

  • Electrophysiological Recordings: Tip recordings from labellar sensilla, particularly S6 sensilla, can measure action potential frequencies in response to Gr64e ligands. This technique has been critical in demonstrating the direct involvement of Gr64e in sensing specific compounds .

  • Genetic Manipulation Approaches:

    • CRISPR/Cas9-mediated deletion of the entire Gr64 cluster (Gr64af) or specific genes

    • RNAi-mediated knockdown using the GAL4/UAS system

    • Rescue experiments using UAS-Gr64e transgenes in mutant backgrounds

  • Calcium Imaging: To visualize neuronal activation patterns in response to gustatory stimuli .

  • Optogenetic Activation: Using tools like ReaChR to artificially activate sweet-sensing neurons and test downstream functional dependencies .

What are the established ligands for Gr64e and how specific are these interactions?

Research has identified the following ligands for Gr64e:

Ligand TypeSpecific CompoundsResponse MechanismCitations
Glycerol5% glycerol solutionsDirect ligand-gated ion channel
Fatty AcidsHexanoic acid (HxA), Octanoic acid (OcA), Oleic acid (OA), Linoleic acid (LA)Indirect via PLC signaling pathway

Gr64e shows specificity in its ligand interactions. Mutational studies have demonstrated that Gr64e is required for behavioral and electrophysiological responses to glycerol and fatty acids, but not to other compounds such as sugars like sucrose, glucose, and fructose, which are primarily sensed through other Gr64 receptors (particularly Gr64a) . Interestingly, while Gr64e is essential for responses to various fatty acids at 0.4% concentration, the mechanism of action differs from its glycerol-sensing function .

How does Gr64e employ distinct molecular mechanisms for different sensory modalities?

Gr64e exhibits remarkable functional versatility through context-dependent mechanistic switching:

  • Glycerol Sensing: For glycerol detection, Gr64e functions as a direct ligand-gated ion channel. This mechanism involves direct binding of glycerol to the receptor, resulting in channel opening and neuronal depolarization without requiring secondary messengers .

  • Fatty Acid Sensing: In contrast, fatty acid detection by Gr64e operates through an indirect signaling cascade. Experimental evidence shows that Gr64e acts downstream of phospholipase C (PLC) in the fatty acid signaling pathway . The pathway involves:

    • Initial detection of fatty acids (mechanism not fully elucidated)

    • Activation of PLC (encoded by norpA in Drosophila)

    • Signal transduction through Gr64e

    • Neuronal activation and behavioral response

This dual mechanism is further supported by interchangeability experiments, where TRPA1 can substitute for Gr64e in fatty acid sensing but not glycerol sensing, demonstrating that the mechanisms are fundamentally different . This functional plasticity represents an evolutionary adaptation allowing a single receptor to mediate responses to diverse chemical compounds.

What is the newly discovered role of Gr64e in proteostasis, and how does this relate to its sensory function?

Recent research has uncovered a surprising non-neuronal function of Gr64e and the Gr64 cluster in maintaining cellular proteostasis:

  • Expression in Non-Neuronal Tissues: While Gr64 receptors were previously thought to be primarily expressed in gustatory neurons, they are upregulated in epithelial cells (particularly in Drosophila imaginal discs) under conditions of proteotoxic stress .

  • Pro-Survival Function: Cells heterozygous for ribosomal protein mutations (Rp/+), which experience proteotoxic stress, become dependent on Gr64 receptors for survival. Loss of Gr64 in Rp/+ cells exacerbates stress pathway activation and increases apoptosis .

  • Cellular Mechanisms: Gr64 receptors appear to promote proteostasis by:

    • Positively regulating autophagy pathways

    • Supporting proteasome function

    • Reducing the accumulation of protein aggregates under stress conditions

  • Relationship to Sensory Function: This proteostasis function appears to be mechanistically distinct from the sensory role, as it does not seem to involve direct ligand binding but rather modulation of stress response pathways. Importantly, this function is only essential in cells experiencing proteotoxic stress, as non-stressed cells do not show increased apoptosis when Gr64 is deleted .

This discovery suggests an evolutionary co-option of sensory receptors for cellular stress response, highlighting the multifunctional nature of Gr64 family proteins.

What are the optimal approaches for recombinant expression and purification of Gr64e for structural studies?

Based on techniques used for similar membrane proteins, optimal approaches include:

  • Expression Systems:

    • Insect Cell Expression: Sf9 or High Five cells provide appropriate post-translational modifications and membrane composition for Drosophila proteins

    • Yeast Expression: Pichia pastoris systems have been successful for gustatory receptors

    • Bacterial Expression: E. coli systems with fusion tags (MBP, SUMO) for inclusion body refolding approaches

  • Purification Strategy:

    StepMethodConsiderations
    SolubilizationMild detergents (DDM, LMNG) or lipid nanodiscsPreserve native conformation
    Affinity PurificationHis-tag or Flag-tag purificationN-terminal tags generally less disruptive
    Size ExclusionSuperdex 200 or similarAssess monodispersity
    Functional VerificationLiposome reconstitution with calcium flux assaysConfirm ligand-gated ion channel activity
  • Stabilization Approaches:

    • Thermostabilizing mutations based on computational predictions

    • Antibody fragment complexes to stabilize specific conformations

    • Fusion with crystallization chaperones like T4 lysozyme

  • Structural Determination:

    • Cryo-EM is increasingly successful for membrane proteins of this size

    • X-ray crystallography with LCP (Lipidic Cubic Phase) method

    • NMR approaches for specific domains or fragments

The greatest challenge remains obtaining sufficient quantities of functional, properly folded protein, as gustatory receptors are typically expressed at low levels and can be unstable when removed from their native membrane environment.

How can researchers generate specific mutations in Gr64e without disrupting other Gr64 cluster genes?

Given the tandem arrangement and potential regulatory interdependencies of the Gr64 cluster, targeted manipulation requires careful consideration:

  • CRISPR/Cas9 Precision Editing:

    • Design guide RNAs specific to Gr64e sequences not shared with other Gr64 genes

    • Use homology-directed repair (HDR) with repair templates containing desired mutations

    • Screen for precise edits using sequencing verification

    • The reported success in generating specific Gr64e mutants demonstrates feasibility

  • Rescue-Based Approaches:

    • Generate complete Gr64af cluster deletion using CRISPR/Cas9 as described in the literature

    • Rescue with transgenic constructs containing all Gr64 genes except Gr64e

    • Alternatively, rescue with a mutated version of Gr64e to study specific residues

  • Conditional Expression Systems:

    • Use of temperature-sensitive expression systems

    • GAL80ts for temporal control of RNAi or transgene expression

    • Tissue-specific drivers (like Gr5a-GAL4) to restrict manipulation to relevant cell types

  • Single-Cell Manipulation:

    • MARCM (Mosaic Analysis with a Repressible Cell Marker) technique for generating single-cell clones with Gr64e mutations

    • FlpOut systems for stochastic expression of transgenes or RNAi constructs

Researchers have successfully employed these approaches as evidenced by studies using Gr64e-specific GAL4 drivers and UAS-Gr64e rescue constructs to demonstrate specific functions of this receptor .

What are the best methods for validating antibody specificity when studying Gr64e protein?

Validating antibody specificity for Gr64e requires multiple complementary approaches:

  • Genetic Controls:

    • Test antibodies on Gr64e null mutant tissues (complete absence of signal)

    • Test on Gr64e overexpression tissues (enhanced signal)

    • Use CRISPR/Cas9-generated Gr64af deletion mutants as described in the literature

  • Epitope Validation:

    • Express epitope-tagged versions of Gr64e (e.g., FLAG, HA) and confirm co-localization

    • Perform epitope competition assays

    • Use multiple antibodies targeting different epitopes

  • Cross-Reactivity Assessment:

    • Test against tissues expressing only other Gr64 family members

    • Western blotting showing appropriate molecular weight band (absent in knockout)

    • Pre-absorption tests with recombinant Gr64e protein

  • Functional Correlation:

    • Correlate antibody staining with functional responses (e.g., calcium imaging)

    • Correlate with GFP reporter expression driven by Gr64e-GAL4

The high sequence similarity among Gr64 family members (given their tandem arrangement and evolutionary relationship) makes stringent validation particularly important to ensure specificity to Gr64e rather than other gustatory receptors.

How can researchers distinguish between direct and indirect effects of Gr64e in cellular signaling pathways?

Distinguishing direct from indirect signaling effects requires sophisticated experimental approaches:

  • Temporal Analysis of Signaling Events:

    • Use rapid kinetic assays to establish sequence of molecular events

    • Calcium imaging with high temporal resolution

    • Measure PLC activation timing relative to receptor stimulation

  • Reconstitution Experiments:

    • Heterologous expression systems with defined components

    • In vitro reconstitution with purified proteins

    • Cell-free systems to test direct interactions

  • Interaction Mapping:

    • Co-immunoprecipitation to identify protein complexes

    • Proximity labeling techniques (BioID, APEX)

    • FRET/BRET assays to detect direct molecular interactions

  • Domain Swap and Chimeric Receptors:

    • Create chimeras between Gr64e and other Grs with different signaling properties

    • Domain swapping to identify regions responsible for specific signaling modes

    • Point mutations in putative signaling interfaces

  • Pathway Dissection Using Genetics:

    • Epistasis analysis with various signaling components

    • Double mutant analysis with PLC pathway components

    • Bypass experiments as demonstrated with TRPA1 substitution for Gr64e

Research has already employed some of these approaches, showing that Gr64e functions downstream of PLC in fatty acid sensing but as a direct ion channel for glycerol . These differentiated mechanisms highlight the importance of using multiple complementary approaches.

What approaches can resolve contradictory data regarding Gr64e function across different studies?

When faced with contradictory findings about Gr64e function, researchers should consider:

  • Genetic Background Effects:

    • Use isogenic backgrounds for all comparisons

    • Backcross all mutant lines to control for modifiers (as done in the cited studies)

    • Test multiple independently generated mutations/transgenes

  • Methodological Standardization:

    • Standardize assay conditions (concentration, temperature, age)

    • Use identical methodological parameters across experiments

    • Blind analysis to prevent unconscious bias

  • Cellular Context Considerations:

    • Explicitly test for tissue-specific effects

    • Consider developmental timing of expression

    • Evaluate potential compensation by other receptors

  • Direct Side-by-Side Comparisons:

    • Replicate published experiments with original and new genotypes

    • Collaborate directly with labs reporting contradictory results

    • Perform experiments in multiple laboratories

  • Integrative Analysis:

    • Combine behavioral, electrophysiological, and molecular data

    • Develop quantitative models that might explain apparent contradictions

    • Consider multiple functions of the same protein as demonstrated by Gr64e's dual roles in sensory perception and proteostasis

The literature shows that Gr64e has multiple, context-dependent functions that could appear contradictory if not properly contextualized, emphasizing the importance of comprehensive experimental approaches.

What are the promising research frontiers for understanding Gr64e structure-function relationships?

Several exciting research directions could advance our understanding of Gr64e:

  • Structural Biology Approaches:

    • Cryo-EM structures of Gr64e in different functional states

    • Computational modeling of ligand binding sites

    • Molecular dynamics simulations of channel gating mechanisms

  • Single-Molecule Biophysics:

    • Patch-clamp recordings of recombinant Gr64e

    • Single-molecule FRET to detect conformational changes

    • Force spectroscopy to measure mechanical properties

  • Systems Biology Integration:

    • Multi-omics approaches to identify interaction networks

    • Quantitative modeling of sensory coding involving Gr64e

    • Connectomics of Gr64e-expressing neurons

  • Evolutionary Perspectives:

    • Comparative analysis of Gr64e orthologs across insect species

    • Reconstruction of ancestral Gr64e sequences

    • Linking molecular evolution to ecological adaptation

  • Therapeutic Applications:

    • Structure-based design of insect control compounds targeting Gr64e

    • Exploitation of proteostasis functions for stress response modulation

    • Development of biosensors based on Gr64e ligand specificity

The multifunctional nature of Gr64e—functioning as both a ligand-gated ion channel and a component of PLC signaling, as well as its role in proteostasis—makes it an exceptionally rich system for studying receptor versatility and functional plasticity .

How might the newly discovered proteostasis function of Gr64e relate to human disease mechanisms?

The discovery of Gr64e's role in proteostasis opens intriguing connections to human disease:

  • Ribosomopathies:

    • Ribosomal protein mutations in Drosophila that induce proteotoxic stress model aspects of human ribosomopathies

    • Gr64e could inform understanding of cell survival mechanisms in conditions like Diamond-Blackfan anemia

  • Neurodegenerative Diseases:

    • Protein aggregation is central to diseases like Alzheimer's, Parkinson's, and Huntington's

    • Gr64e's role in reducing proteotoxic stress might reveal conserved protective pathways

  • Cancer Biology:

    • Proteostasis mechanisms are frequently hijacked in cancer cells

    • Understanding how Gr64e promotes survival under stress could reveal new cancer vulnerabilities

  • Stress Response Pathways:

    • The connection between Gr64e and autophagy/proteasome function suggests conserved mechanisms

    • Human taste receptors or related GPCRs might have similar non-canonical functions

  • Evolutionary Medicine:

    • The dual function of Gr64e suggests evolutionary co-option of sensory proteins for cellular homeostasis

    • This principle might apply to human receptor systems with unexplored functions

While direct homologs of Gr64e are not present in humans, the cellular mechanisms of proteostasis are highly conserved, suggesting that insights from this system could have broad translational relevance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.