Recombinant Drosophila melanogaster Probable mitochondrial import inner membrane translocase subunit Tim17 1 (Tim17b1)

Shipped with Ice Packs
In Stock

Description

Gene Information

Gene InformationDetails
NameRecombinant Full Length Drosophila melanogaster Probable Mitochondrial Import Inner Membrane Translocase Subunit Tim17 1(Tim17B1) Protein, His-Tagged
OrganismDrosophila melanogaster (Fruit fly)
FunctionEssential component of the TIM23 complex, mediating the translocation of proteins across the mitochondrial inner membrane
LocationLocalizes in constitutive heterochromatin of Drosophila melanogaster third chromosome
SynonymsTim17b1
Molecular WeightThe recombinant full-length protein consists of 179 amino acids .
TagFused to an N-terminal His tag
ExpressionExpressed in E. coli

Function and Role

  1. Mitochondrial Protein Import: Tim17b1 is crucial for protein delivery to the mitochondrial matrix . Knockdown of Tim17b1 disrupts the functions of the mitochondrial translocase complex, affecting the import of proteins into mitochondria .

  2. TIM23 Complex Component: As a core component of the TIM23 complex, Tim17b1 is involved in the translocation of presequence proteins into the inner membrane or matrix . The TIM23 complex sorts proteins with N-terminal targeting signals (presequences) into the inner membrane or matrix .

  3. Interaction with Preproteins: Tim17 interacts with both matrix-targeted and inner membrane-sorted preproteins during translocation in the native membrane environment .

  4. Stable Localization: Tim17b protein exhibits stable localization in the membranes of the mitochondrial network, with a minimal exchange rate compared to soluble proteins in the mitochondrial matrix .

Research Findings

  1. Impact of Tim17b Knockdown:

    • Disruption of mitochondrial function: Knockdown of Tim17b leads to the formation of abnormal mitochondrial structures and induces apoptosis .

    • Inhibition of protein delivery: Expression of Tim17b RNAi prevents the delivery of proteins into the mitochondrial matrix .

  2. Tim17's Negative Charges:

    • Conserved negative charges within the transmembrane domains of Tim17 are essential for presequence protein translocation .

    • Mutations of these charged residues can result in significant growth defects, highlighting their importance in Tim17 function .

  3. Tim17-Tim23 Interaction:

    • Tim17 interacts with Tim23 in the native lipid environment, and this interaction is crucial for the structural integrity and functionality of the Tim17-Tim23 complex .

    • Specific domains within Tim17 and Tim23, such as TM1 and TM2, are vital for the complex's function and, consequently, for cell viability .

Experimental Evidence

  1. Tim17b-DsRed Localization:

    • Tim17b-DsRed fusion protein localizes properly in mitochondria without disrupting mitochondrial functions, making it an effective marker for studying the mitochondrial translocase complex in vivo .

    • The distribution of Tim17b-DsRed matches the localization of mitochondrial protein ATP-synthase but does not overlap with Golgi or endoplasmic reticulum markers .

  2. RNAi-Mediated Knockdown Effects:

    • Co-expression of Tim17b RNAi diminishes the amount of Tim17b-DsRed protein and disrupts mitochondrial structure .

    • Transmission electron microscopy (TEM) analysis reveals that typical mitochondria are scarce in Tim17b RNAi-expressing cells, with abnormal structures containing residual cristae observed instead .

  3. Protein Delivery Assay:

    • Co-expression of Tim17b RNAi and mito-GFP (a reporter protein for mitochondrial import) results in the accumulation of mito-GFP in the cytosol rather than in mitochondria .

    • This indicates that disruption of Tim17b protein production prevents the delivery of new mitochondrial proteins, while the localization of pre-existing proteins like ATP-synthase remains unaffected .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tim17b1; CG1158; Probable mitochondrial import inner membrane translocase subunit Tim17 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Tim17b1
Target Protein Sequence
MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSG LVGGNFAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGG ALLALIEGVGIVVSHYSADSYRQVSPVERQQRYKQELLRQQKGVSPLAATYGEIDSSAL
Uniprot No.

Target Background

Function
An essential component of the TIM23 complex, which facilitates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Database Links

KEGG: dme:Dmel_CG1158

STRING: 7227.FBpp0078430

UniGene: Dm.13416

Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the chromosomal location of Tim17b in Drosophila melanogaster?

Tim17b is located within the constitutive heterochromatin of the third chromosome in Drosophila melanogaster. This heterochromatic positioning presents unique challenges for genetic manipulation and expression studies. The gene is situated among various retrotransposable and transposable repeated DNA elements, with the closest characterized locus being Parp . This heterochromatic location necessitates specialized approaches for genetic manipulation, including the use of specific vector systems that can effectively target heterochromatic regions.

What is the primary function of Tim17 in mitochondrial protein import?

Tim17 functions as an essential membrane-embedded subunit of the presequence translocase complex that facilitates the import of proteins with N-terminal presequences into mitochondria. Its primary role involves coupling the import motor to the translocation channel, effectively serving as a bridge between these two critical components of the mitochondrial protein import machinery . This function is evolutionarily conserved across species, though the specific protein partners may vary between organisms such as yeast, humans, plants, and trypanosomatids .

How is the structure of Tim17 organized to support its function?

Tim17 contains four transmembrane (TM) segments with functionally distinct roles:

Transmembrane SegmentPrimary FunctionInteracting Partners
TM1Channel formationTim23
TM2Channel formationTim23
TM3Import motor bindingPAM complex components
TM4Structural supportVarious

The matrix-facing regions of Tim17, particularly those associated with TM3, contain specific residues involved in binding the import motor components . This structural organization enables Tim17 to facilitate the handover of translocating proteins from the channel to the import motor, a critical step in mitochondrial protein import.

What are the most effective strategies for generating Tim17b knockdown in Drosophila melanogaster?

For effective Tim17b knockdown in Drosophila, an RNAi-based approach utilizing the UAS-GAL4 system has proven successful. The design should include:

  • Construction of a transgene containing inverted repeats of Tim17b cDNA fragments (300-500 bp) separated by a spacer sequence

  • Integration of the knockdown construct into a vector containing UAS elements

  • Development of a parallel fluorescent reporter transgene (such as DsRed) under similar regulatory control to monitor expression

A practical example comes from research where a UAS-Tim17b RNAi transgene was generated by cloning a 354 bp fragment of Tim17b cDNA as inverted repeats . When expressed under tissue-specific GAL4 drivers, this construct achieves targeted knockdown without the complications of completely removing this essential gene.

How can researchers effectively measure Tim17 interaction with other components of the protein import machinery?

To effectively measure Tim17 interactions with other components of the protein import machinery, researchers should employ a multi-faceted approach:

  • Co-immunoprecipitation assays: Using antibodies against Tim17 to pull down protein complexes, followed by Western blotting to identify interacting partners. This method has successfully demonstrated Tim17's association with Tim23 and import motor components .

  • Site-directed mutagenesis: Systematic mutation of residues in different transmembrane segments can reveal functional interactions. For example, mutations in TM1 and TM2 have been shown to impair interaction with Tim23, while mutations in TM3 compromise binding of the import motor .

  • Cross-linking experiments: Chemical cross-linking followed by mass spectrometry can identify proximity relationships between Tim17 and other proteins in the intact mitochondria.

  • Blue Native PAGE: This technique allows for analysis of intact protein complexes and can reveal different complex sizes and compositions containing Tim17, as demonstrated in studies of trypanosomatid TbTim17 which exists in complexes ranging from 300 kDa to 1100 kDa .

What experimental approaches can distinguish the functions of different Tim17 transmembrane domains?

To distinguish the functions of different Tim17 transmembrane domains, researchers should implement the following experimental approaches:

  • Domain-specific mutations: Introducing point mutations or small deletions in individual transmembrane segments followed by functional assays. Studies have demonstrated that mutations in TM1 and TM2 specifically impair interaction with Tim23, whereas mutations in TM3 affect import motor binding .

  • Chimeric protein construction: Creating fusion proteins where individual transmembrane segments are exchanged with corresponding regions from related proteins (such as Tim22) to determine domain-specific functions.

  • In vitro import assays: Using mitochondria isolated from strains expressing mutated versions of Tim17 to assess import efficiency of different substrate proteins. This approach can reveal which transmembrane domains are critical for specific substrate classes.

  • Structural analysis: Employing techniques such as cysteine scanning mutagenesis combined with cross-linking to map the positioning of transmembrane domains relative to other components of the import machinery.

How should researchers address contradictory results when studying Tim17b function in different experimental systems?

When confronting contradictory results in Tim17b function studies, researchers should implement a systematic troubleshooting approach:

  • Standardize experimental conditions: Variations in temperature, buffer composition, or developmental stage of Drosophila can significantly impact mitochondrial import efficiency. Establish consistent protocols across experiments.

  • Validate knockdown efficiency: Quantify the actual reduction in Tim17b expression using RT-qPCR and Western blot analyses. Incomplete knockdown may lead to residual activity and inconsistent phenotypes.

  • Consider genetic background effects: The heterochromatic location of Tim17b may interact differently with various genetic backgrounds. Always include appropriate genetic controls matched to the experimental strains.

  • Examine compensatory mechanisms: Other Tim family proteins might compensate for reduced Tim17b function. A comprehensive analysis should include examination of expression changes in related genes.

  • Cross-validate with multiple techniques: Combine biochemical approaches (such as import assays) with in vivo studies (such as mitochondrial morphology and function) to build a more complete understanding of contradictory results.

What are the critical variables that influence the success of Tim17b1 functional studies?

Several critical variables significantly influence Tim17b1 functional studies:

VariableImpactRecommendation
Developmental timingTim17b1 function may vary across developmental stagesUse precisely staged animals or tissues
Tissue specificityImport requirements differ between tissuesCompare results across multiple tissue types
TemperatureAffects mitochondrial import kineticsMaintain consistent temperature conditions
Genetic backgroundMay contain modifiers affecting Tim17b1 functionUse isogenic backgrounds where possible
Knockdown efficiencyPartial knockdown may mask phenotypesVerify knockdown at both RNA and protein levels
Mitochondrial isolation qualityDamaged mitochondria alter import capacityOptimize isolation protocols for each tissue type

Researchers should systematically control these variables to ensure reproducible results when studying Tim17b1 function . Documentation of these variables in published methods is essential for replication studies.

How can researchers validate that phenotypes observed in Tim17b knockdown studies are specific?

To validate the specificity of phenotypes observed in Tim17b knockdown studies, researchers should implement the following complementary approaches:

  • Rescue experiments: Reintroduce wild-type Tim17b using a knockdown-resistant construct (e.g., with synonymous mutations in the targeted sequence). Phenotype reversal confirms specificity .

  • Multiple RNAi constructs: Utilize non-overlapping RNAi constructs targeting different regions of Tim17b. Consistent phenotypes across different constructs support specificity.

  • Titration experiments: Implement different levels of knockdown using temperature-sensitive GAL4 drivers or RNAi expression systems to establish a dose-dependent relationship between Tim17b levels and observed phenotypes.

  • Analysis of off-target effects: Perform transcriptome analysis to identify any unintended gene expression changes caused by the RNAi construct.

  • Functional complementation: Test whether the related protein Tim17a can functionally substitute for Tim17b, which would indicate partial redundancy versus specific functions.

What are the most effective methods for visualizing Tim17b1 localization and dynamics in living cells?

For optimal visualization of Tim17b1 localization and dynamics in living cells, researchers should consider these methodological approaches:

  • Fluorescent protein tagging: Generate a Tim17b1-fluorescent protein fusion (such as Tim17b-DsRed ) that maintains functionality. The tag should be positioned to minimize disruption of transmembrane domains or functional regions.

  • Super-resolution microscopy: Employ techniques such as STED or PALM to overcome the diffraction limit when studying the submitochondrial localization of Tim17b1 within the inner membrane.

  • FRAP analysis (Fluorescence Recovery After Photobleaching): Use this technique to measure the mobility and turnover rate of Tim17b1 within the mitochondrial membrane.

  • Split-GFP approach: Implement a complementation assay where segments of GFP are attached to Tim17b1 and potential interacting partners, with fluorescence occurring only upon protein interaction.

  • Optogenetic tools: Develop light-activated versions of Tim17b1 to study its function in real-time within living cells.

These approaches should be calibrated against mitochondrial markers to confirm proper localization and function of the tagged protein.

What experimental controls are essential when studying Tim17b1 interactions with the import motor?

When studying Tim17b1 interactions with the import motor, the following controls are essential:

  • Negative interaction controls: Include transmembrane proteins not involved in protein import (such as components of respiratory complexes) to confirm specificity of observed interactions.

  • Domain mutation controls: Compare wild-type Tim17b1 with versions containing mutations in domains not expected to affect import motor binding (based on studies showing TM3 specifically affects motor interactions ).

  • Substrate controls: Use a panel of different mitochondrial preproteins with varying characteristics (length, charge, folding status) to ensure the observed interactions are physiologically relevant.

  • ATP-dependence controls: Since import motor function is ATP-dependent, experiments should include conditions with ATP depletion or non-hydrolyzable ATP analogs to confirm energy requirements.

  • Temperature controls: Compare interactions at physiological temperature versus reduced temperature (where motor activity is slowed) to distinguish stable interactions from transient ones.

What model systems beyond Drosophila can provide comparative insights into Tim17 function?

Several model systems beyond Drosophila can provide valuable comparative insights into Tim17 function:

OrganismAdvantagesKey Tim17 Features
Saccharomyces cerevisiaeGenetic tractability, established mitochondrial isolation protocolsContains single Tim17 that interacts with Tim23 and import motor
Trypanosoma bruceiUnique mitochondrial biology, evolutionary divergenceTbTim17 exists in larger protein complexes (300-1100 kDa) with trypanosome-specific components
Mammalian cell linesMedical relevance, tissue-specific studies possibleContains TIMM17A and TIMM17B paralogs with potential specialized functions
PlantsUnique mitochondrial dynamics, developmental regulationTim17 interacts with different partner proteins than in animals or fungi

Cross-species comparison of Tim17 function has revealed both conserved mechanisms and organism-specific adaptations in mitochondrial protein import. For instance, trypanosomatids possess a unique TIM complex where TbTim17 associates with trypanosome-specific proteins including TbTim62, TbTim42, and TbTim54 , highlighting evolutionary adaptations in protein import machinery.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.