Recombinant Drosophila melanogaster Probable mitochondrial import inner membrane translocase subunit Tim17 3 (Tim17a1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Tim17a1; CG10090; Probable mitochondrial import inner membrane translocase subunit Tim17 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Tim17a1
Target Protein Sequence
MEYNRQPCPIRIVEDCGCAFMMGTIGGSLFEFLKGFRNAPTGLQRRLYGGIDLVKMRTPS IAGSFAVWGATFSTVDCALVHYRQREDAWNSILSGAATGGILAARNGIRAMANSALVGCL VLAMIEGAGAAVATINAADKGAGIVIKPQRAQWEAILETIDPKRASSTQDFALAEFERVL DKCRASREPNLLQDIPVKSHERDSKQKPFYSLLDLVKLSQMF
Uniprot No.

Target Background

Function
An essential component of the TIM23 complex, which facilitates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Database Links

KEGG: dme:Dmel_CG10090

STRING: 7227.FBpp0082080

UniGene: Dm.11868

Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Tim17 in Drosophila melanogaster?

Tim17 is an essential component of the mitochondrial protein import machinery, specifically as part of the inner membrane translocase complex (TIM23 complex). In Drosophila, Tim17b functions critically in the delivery of proteins with N-terminal presequences to the mitochondrial matrix and inner membrane. Studies demonstrate that Tim17b is required strictly for protein delivery to the mitochondrial matrix, and knockdown of Tim17b completely disrupts functions of the mitochondrial translocase complex .

The protein contains four transmembrane (TM) segments with functionally distinct roles: TM1 and TM2 primarily mediate interactions with Tim23 (a component of the translocation channel), while TM3 is involved in binding the import motor . This structural arrangement is essential for handing over translocating proteins from the channel to the import motor during their import into mitochondria.

How does Tim17 differ from other components of the mitochondrial import machinery?

Tim17 has a very stable localization in the mitochondrial inner membrane with an exchange rate close to zero compared to soluble proteins of the mitochondrial matrix . This stability suggests Tim17 serves as a structural anchor within the translocase complex. Unlike some other components that may have redundant functions, Tim17b appears to be indispensable, as demonstrated by the embryonic lethality observed when the gene is knocked down, with less than 5% of embryos surviving to second or third instar stages .

The functional specificity of Tim17 is evident in its distinct domains: while certain regions interact with the channel component (Tim23), others specifically bind to the import motor . This dual interaction capability makes Tim17 unique in coordinating the translocation process from the channel to the motor component of the import machinery.

What are effective strategies for studying Tim17 function in Drosophila melanogaster?

Several complementary approaches have proven effective for investigating Tim17 function:

  • Fluorescent reporter systems: Creating transgenic Drosophila expressing Tim17b-DsRed fusion protein allows visualization of Tim17b localization in vivo. This approach confirms mitochondrial localization by co-staining with mitochondrial markers like ATP-synthase .

  • RNAi-based knockdown: Transgenic RNAi targeting Tim17b effectively disrupts its function. This can be accomplished by cloning full-length Tim17b cDNA in direct and reverse orientation separated by spacer DNA into a vector like pUASt .

  • Temporal control of expression: Using inducible drivers like heat shock hs::GAL4 allows spatially and temporally controlled expression of both reporter constructs and RNAi, enabling the study of immediate effects of Tim17b depletion without broad cytotoxic effects .

  • Functional assays: Employing reporter proteins with mitochondrial targeting sequences (e.g., mito-GFP) to track protein import efficiency when Tim17b is depleted or mutated .

  • Ultrastructural analysis: Transmission electron microscopy (TEM) to examine mitochondrial morphology and structure in tissues expressing Tim17b RNAi .

The combination of these approaches provides comprehensive insights into both the localization and function of Tim17b in Drosophila.

How can researchers effectively visualize Tim17 localization and dynamics in living tissues?

Tim17b-DsRed fluorescent reporter protein provides an excellent tool for visualizing Tim17 localization and dynamics in living tissues. The recommended methodology includes:

  • Expression system: Use the UAS-GAL4 system with appropriate tissue-specific or ubiquitous GAL4 drivers to express UAS::Tim17b-DsRed transgene .

  • Confirmation of proper localization: Verify mitochondrial localization by co-staining with established mitochondrial markers like ATP-synthase, while confirming lack of overlap with other organelle markers (Golgi, endoplasmic reticulum) .

  • Live imaging protocol: For dynamic studies, dissect living tissue from strains expressing Tim17b-DsRed and perform time-lapse confocal microscopy. This approach allows tracking the migration of individual mitochondria in tissues such as larval salivary glands .

  • Network visualization: Examine metabolically active tissues, particularly larval intestine cells, to observe interconnected mitochondrial networks where Tim17b-DsRed reveals the organization of these mega-organelles .

  • FRAP analysis: Fluorescence Recovery After Photobleaching can be employed to study the dynamics and mobility of Tim17b within the mitochondrial membrane, confirming its stable integration with minimal exchange .

This methodology enables both static localization studies and dynamic tracking of mitochondrial behavior in living Drosophila tissues.

How does Tim17 interact with other components of the mitochondrial import machinery?

Tim17 interacts with multiple components of the mitochondrial import machinery through its distinct structural domains:

Tim17 RegionInteracting PartnerFunctional OutcomeExperimental Evidence
TM1 and TM2Tim23Formation of translocation channelMutations in TM1 and TM2 impair interaction with Tim23
TM3Import motor componentsCoupling of import motor to channelMutations in TM3 compromise binding of import motor
Matrix-facing regionImport motorBinding of motor to translocaseSpecific residues identified involved in motor binding

These interactions are critical for the stepwise process of protein import, where proteins with N-terminal presequences are first threaded through the channel formed by Tim17 and Tim23, then handed over to the import motor at the matrix face of the inner membrane . The distinct roles of different Tim17 regions explain how it facilitates the transfer of translocating proteins from the channel to the motor component.

What are the consequences of Tim17 dysfunction on mitochondrial structure and function?

Tim17 dysfunction has profound effects on mitochondrial structure and function:

  • Structural abnormalities: TEM analysis of tissues expressing Tim17b RNAi reveals a scarcity of typical mitochondria. Instead, abnormal structures surrounded by double membranes with residual cristae are observed .

  • Protein import defects: Tim17b knockdown blocks the delivery of proteins with mitochondrial targeting sequences (like mito-GFP) to the mitochondrial matrix. When Tim17b RNAi is expressed, mito-GFP accumulates in the cytosol rather than colocalizing with mitochondrial markers .

  • Cellular consequences: Expression of Tim17b RNAi stimulates apoptosis, highlighting the essential nature of functional mitochondrial protein import for cell survival .

  • Developmental effects: Severe Tim17b knockdown results in embryonic lethality, with less than 5% of embryos surviving to later developmental stages, demonstrating the essential nature of this protein for organismal development .

These findings confirm that Tim17b is indispensable for mitochondrial function, particularly for the import of proteins destined for the mitochondrial matrix, and that its dysfunction has catastrophic consequences for both mitochondrial structure and cellular viability.

How can Tim17-DsRed be utilized for studying mitochondrial dynamics and network formation?

Tim17b-DsRed serves as a powerful tool for investigating mitochondrial dynamics in vivo:

  • Real-time tracking: Time-lapse confocal microscopy of tissues expressing Tim17b-DsRed enables tracking of individual mitochondria migration in the cytoplasm of living cells, such as larval salivary glands .

  • Network visualization: In metabolically active tissues like larval intestine, Tim17b-DsRed reveals interconnected mitochondrial networks where individual mitochondria form mega-organelles. This allows the study of mitochondrial morphology and organization in different cell types and physiological conditions .

  • Fusion-fission dynamics: By combining Tim17b-DsRed with photoactivatable or photoconvertible fluorescent proteins, researchers can track subpopulations of mitochondria to study fusion and fission events.

  • Response to metabolic challenges: Tim17b-DsRed can be used to monitor changes in mitochondrial morphology, distribution, and networking in response to environmental stressors, dietary interventions, or genetic manipulations.

  • Developmental transitions: The reporter allows visualization of mitochondrial remodeling during tissue development, metamorphosis, and aging.

This methodology provides advantages over conventional mitochondrial visualization techniques by combining the specificity of targeting an essential mitochondrial translocase component with the ability to perform live imaging in intact tissues.

What approaches can be used to study epistatic interactions between Tim17 and other genes involved in mitochondrial function?

To investigate epistatic interactions between Tim17 and other mitochondrial genes, several sophisticated approaches can be employed:

  • Double knockdown/overexpression experiments: Combine Tim17b RNAi with knockdown or overexpression of other mitochondrial genes to assess synergistic or antagonistic effects. This can be accomplished using the UAS-GAL4 system to simultaneously express multiple constructs .

  • Recombinant inbred lines (RILs): Similar to approaches used for studying complex traits in Drosophila, RILs can be developed to investigate genetic interactions affecting mitochondrial function. These panels are powerful for mapping quantitative trait loci (QTLs) and analyzing epistatic interactions .

  • Interaction LOD score analysis: For quantitative phenotypes related to mitochondrial function, implement statistical methods like LOD score analysis to detect significant interactions between genetic loci. This approach can identify epistatic effects between Tim17 and other genetic regions .

  • Simulation-based approaches: To distinguish true epistatic interactions from additive effects, implement simulation models. This can involve modifying the empirical effect of focal QTLs based on the genotype of potentially interacting genomic windows, as demonstrated for other complex traits in Drosophila .

  • Rescue experiments: Test whether overexpression of interacting genes can rescue phenotypes caused by Tim17b knockdown, or vice versa, to establish functional relationships.

These approaches can reveal whether Tim17 functions independently or shows synergistic or antagonistic interactions with other components of mitochondrial import machinery or other mitochondrial processes.

What are common challenges in generating and working with Tim17 knockdown flies, and how can they be addressed?

Researchers may encounter several challenges when working with Tim17 knockdown flies:

  • Early lethality: As Tim17b knockdown causes embryonic lethality with less than 5% survival to larval stages , researchers may struggle to obtain sufficient material for experiments.

    • Solution: Use inducible or tissue-specific GAL4 drivers rather than ubiquitous drivers to restrict Tim17b knockdown spatially or temporally. The heat shock hs::GAL4 driver has been successfully used to induce knockdown at specific developmental stages .

  • Incomplete knockdown: Variable RNAi efficiency may result in incomplete Tim17b knockdown.

    • Solution: Verify knockdown efficiency by co-expressing Tim17b-DsRed with the RNAi construct and quantifying the reduction in fluorescence. Western blot analysis can also confirm reduction in endogenous Tim17b levels .

  • Secondary effects: Distinguishing direct effects of Tim17b knockdown from secondary consequences of mitochondrial dysfunction.

    • Solution: Perform time-course experiments following induction of Tim17b RNAi to identify primary effects before broad mitochondrial dysfunction occurs. Early timepoints after induction may reveal direct consequences of Tim17b depletion .

  • Specificity concerns: Ensuring RNAi specificity and avoiding off-target effects.

    • Solution: Design and test multiple independent RNAi constructs targeting different regions of Tim17b. Rescue experiments expressing RNAi-resistant Tim17b variants can confirm specificity.

  • Developmental timing: Developmental stage-dependent effects of Tim17b knockdown.

    • Solution: Use stage-specific GAL4 drivers or temperature-sensitive GAL80 to control the timing of knockdown initiation precisely.

These strategies can help overcome the challenges associated with studying an essential gene like Tim17b in Drosophila.

What methodological considerations are important when using Tim17-DsRed for live imaging of mitochondria?

When using Tim17b-DsRed for live imaging of mitochondria, researchers should consider several methodological factors:

  • Expression level optimization: Overexpression of Tim17b-DsRed might potentially affect mitochondrial function or morphology.

    • Recommendation: Titrate GAL4 driver strength or use temperature-sensitive GAL4 systems to achieve appropriate expression levels. Verify that flies expressing Tim17b-DsRed show normal development, fertility, and mitochondrial function .

  • Phototoxicity and photobleaching: Extended imaging may cause phototoxicity or photobleaching.

    • Recommendation: Minimize laser power and exposure time. For long-term imaging, use interval-based acquisition rather than continuous imaging. Consider oxygen scavenging systems in the imaging medium to reduce phototoxic effects.

  • Tissue preparation: Different tissues require specific preparation techniques.

    • Recommendation: For larval tissues like salivary glands and intestine, quick dissection in appropriate physiological buffers is critical. Maintain temperature control during imaging to preserve mitochondrial dynamics .

  • Co-visualization strategies: Combining Tim17b-DsRed with other markers.

    • Recommendation: When co-visualizing with other fluorescent proteins like mitochondrial matrix markers, consider spectral separation and use sequential scanning to avoid bleed-through. Verify that Tim17b-DsRed doesn't overlap with Golgi or endoplasmic reticulum markers to confirm specificity .

  • Quantification approaches: Extracting meaningful data from dynamic imaging.

    • Recommendation: Develop standardized protocols for quantifying parameters like mitochondrial size, shape, velocity, and network connectivity. For FRAP studies, establish consistent protocols for bleaching and recovery measurement to assess Tim17b dynamics in the membrane .

Following these methodological considerations will help ensure reliable and reproducible results when using Tim17b-DsRed for live mitochondrial imaging in Drosophila tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.