Recombinant Drosophila melanogaster Probable mitochondrial import inner membrane translocase subunit Tim17 4 (Tim17a2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Tim17a2 (UniProt ID: Q9VN97) is a mitochondrial translocase subunit critical for importing nucleus-encoded proteins into the mitochondrial matrix. It belongs to the TIM23 complex, which translocates presequence-containing proteins across the inner mitochondrial membrane (IMM) using a membrane potential-dependent mechanism . In Drosophila melanogaster, Tim17a2 is localized to constitutive heterochromatin on chromosome 3 and is ubiquitously expressed, unlike its paralogs Tim17b1 and Tim17b2, which are tissue-specific .

Protein Architecture

FeatureDescription
SourceDrosophila melanogaster (fruit fly); recombinant expression in E. coli
TagN-terminal His-tag (6xHis) for purification and detection
LengthFull-length (1–224 amino acids)
Amino Acid SequenceMEYNRQPCPIRIVEDCGCAFMMGTMGGSLFQYLKGFRNAPSGLRRGLHGGIESVRLRTPA... (partial)
Topological DomainsPredicted 4 transmembrane (TM) segments with matrix-facing regions

Tim17a2 interacts with Tim23 (channel-forming subunit) and Tim44 (import motor anchor) . Mutational studies reveal distinct functional regions:

  • TM1/TM2: Mediate Tim23 binding .

  • TM3: Critical for coupling the translocase to the import motor (e.g., mtHsp70) .

  • Matrix-facing loops: Bind Tim44 and facilitate protein handover to the motor .

Expression and Purification

ParameterDetails
Expression SystemE. coli (BL21(DE3) strain)
Purity>85–90% (SDS-PAGE validated)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
StabilityLyophilized form: 12 months at -20°C/-80°C; liquid: 6 months at -20°C/-80°C

Functional Validation

  • Mitochondrial Localization: Confocal microscopy confirms localization to mitochondrial networks in Drosophila tissues .

  • Import Deficiency: RNAi knockdown of Tim17a2 disrupts mitochondrial protein import (e.g., mito-GFP accumulation in cytosol) .

  • FRAP Analysis: Tim17a2-DsRed exhibits minimal fluorescence recovery after photobleaching, indicating stable membrane integration .

Protein Translocation

Tim17a2 facilitates the import of presequence-containing proteins via the TIM23 pathway:

  1. Receptor Binding: Tim50/Tim23 recognize presequence in IMS .

  2. Membrane Potential-Dependent Translocation: Presequence engages Tim23/17 channel .

  3. Motor Coupling: Tim44 anchors mtHsp70 to Tim17a2, enabling ATP-dependent pulling into the matrix .

Mitochondrial Dynamics and Disease

  • Apoptosis Regulation: Tim17a2 depletion induces mitochondrial structural defects (e.g., loss of cristae) and apoptosis in Drosophila .

  • Cancer Relevance: Mitochondrial translocase dysfunction correlates with altered cristae and metabolic shifts in cancer cells .

Research Applications

ApplicationMethodology/Outcome
Mitochondrial DynamicsLive-cell imaging of Tim17a2-DsRed to track mitochondrial network fusion/fission .
Protein Import StudiesCo-expression with mito-GFP to assay TIM23-dependent import efficiency .
Therapeutic TargetingRNAi-mediated knockdown for studying mitochondrial dysfunction in disease models .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tim17a2; CG14666; Probable mitochondrial import inner membrane translocase subunit Tim17 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Tim17a2
Target Protein Sequence
MEYNRQPCPIRIVEDCGCAFMMGTMGGSLFQYLKGFRNAPSGLRRGLHGGIESVRLRTPA IAGSFAIWGATFSTVDCVMVSYRQREDSWNAIVSGAATGGILAARNGIRAMANSAFVGCL VLAMLEGAGAAVATIYASDGGVKAEESLITVDQQMQRPQWETSVADSNLTGAELERVLDE CRAYRAHNKMQQPMRSDAVEGKELGQLMKPMHSLVDLVKLAEIV
Uniprot No.

Target Background

Function
Essential component of the TIM23 complex, which mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Database Links

KEGG: dme:Dmel_CG14666

STRING: 7227.FBpp0078462

UniGene: Dm.29768

Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Tim17a2 and what is its primary function in Drosophila melanogaster?

Tim17a2 is a probable mitochondrial import inner membrane translocase subunit in Drosophila melanogaster. Similar to the well-characterized Tim17b protein, it functions as a critical component of the mitochondrial protein import machinery. The primary function of Tim17a2 is to facilitate the translocation of nuclear-encoded proteins across the mitochondrial inner membrane into the mitochondrial matrix .

Experimental evidence indicates that Tim17 proteins are essential for maintaining proper mitochondrial function. Knockdown studies of related Tim17 proteins show complete disruption of mitochondrial translocase complex functions, demonstrating that these proteins are strictly required for protein delivery to the mitochondrial matrix . This function is evolutionarily conserved across species, as similar roles have been observed in plant homologs like Arabidopsis TIM17-2 .

How can researchers effectively express and purify recombinant Tim17a2?

For researchers requiring purified Tim17a2 protein for biochemical or structural studies, recombinant expression systems have been developed. The most successful approach reported involves heterologous expression in E. coli with a histidine tag for purification purposes . The complete protocol includes:

  • Cloning the full-length Tim17a2 coding sequence into a bacterial expression vector with an N-terminal or C-terminal His-tag

  • Transforming the construct into an E. coli expression strain optimized for membrane protein production

  • Inducing protein expression under controlled conditions

  • Lysing cells and solubilizing membrane fractions with appropriate detergents

  • Purifying the His-tagged protein using nickel affinity chromatography

  • Verifying protein identity and purity through Western blotting and mass spectrometry

Researchers should note that as a membrane protein, Tim17a2 presents challenges for solubilization and maintaining proper folding during purification. Optimization of detergent conditions is often necessary to retain functional integrity of the purified protein.

What techniques can be used to study Tim17a2 subcellular localization?

Multiple complementary approaches can be employed to study the subcellular localization of Tim17a2:

  • Fluorescent fusion proteins: Creating GFP or RFP fusions with Tim17a2 allows for live-cell imaging of protein localization. Based on studies of related proteins like Tim17b, these constructs would be expected to localize to the mitochondrial network .

  • Immunofluorescence microscopy: Using antibodies specific to Tim17a2 or to an epitope tag on recombinant Tim17a2 can reveal its distribution within fixed cells.

  • Subcellular fractionation: Biochemical separation of mitochondria followed by Western blotting can confirm mitochondrial localization and further distinguish between outer membrane, inner membrane, and matrix fractions.

  • Immuno-electron microscopy: This technique provides the highest resolution for precisely determining the submitochondrial localization of Tim17a2.

Studies of the related Tim17b protein have demonstrated that it has a very stable localization in the mitochondrial inner membrane with minimal protein turnover, as determined by fluorescent recovery after photobleaching (FRAP) assays . Similar stability would be expected for Tim17a2, though direct experimental confirmation is needed.

How can researchers measure Tim17a2 protein turnover and membrane dynamics?

Fluorescent recovery after photobleaching (FRAP) has proven to be an excellent technique for studying the dynamics of Tim17 proteins in the mitochondrial membrane. The methodology includes:

  • Expressing fluorescently tagged Tim17a2 in Drosophila cells

  • Selecting a region of interest within the mitochondrial network for photobleaching

  • Applying a high-intensity laser pulse to bleach fluorescence in the target region

  • Monitoring fluorescence recovery over time through time-lapse imaging

  • Analyzing recovery curves to determine the mobile fraction and half-time of recovery

Studies with Tim17b revealed that it has an exchange rate close to zero when compared with soluble proteins of the mitochondrial matrix, indicating extremely stable integration into the membrane . This technique can determine whether Tim17a2 shares this stability characteristic or has different dynamic properties.

What are the most effective methods for generating Tim17a2 knockdown in Drosophila melanogaster?

Several approaches have been developed for knocking down Tim17a2 expression in Drosophila:

  • RNAi-based knockdown constructs: Similar to those developed for Tim17b, researchers can create transgenic RNAi constructs targeting Tim17a2. These typically involve cloning short inverted repeats of the Tim17a2 sequence separated by an intron into a vector under the control of a UAS promoter for GAL4-driven expression .

  • CRISPR/Cas9 genome editing: This approach can generate precise mutations or deletions in the Tim17a2 gene.

  • P-element insertion: The Exelixis collection and other Drosophila mutant libraries may contain lines with P-element insertions that disrupt Tim17a2 function .

For effective validation of knockdown efficiency, researchers should:

  • Perform qRT-PCR to measure Tim17a2 mRNA levels

  • Use Western blotting to assess protein levels

  • Include appropriate controls, such as non-targeting RNAi constructs

  • Evaluate phenotypic effects in tissues known to be sensitive to mitochondrial dysfunction

What phenotypes are associated with Tim17a2 disruption in Drosophila?

While specific phenotypes for Tim17a2 disruption have not been fully characterized in the provided sources, insights can be drawn from studies of related proteins and mitochondrial import machinery:

  • Developmental effects: Severe disruption of mitochondrial protein import typically leads to developmental arrest or lethality, particularly in tissues with high energy demands.

  • Neurodegenerative phenotypes: Mitochondrial dysfunction is often associated with neurodegeneration, similar to the eye degeneration phenotypes observed in Drosophila models of ALS .

  • Metabolic abnormalities: Disruption of mitochondrial function affects energy metabolism, potentially leading to changes in lifespan, stress resistance, and other metabolic parameters.

  • Cellular phenotypes: At the cellular level, researchers may observe:

    • Altered mitochondrial morphology

    • Changes in mitochondrial membrane potential

    • Reduced ATP production

    • Increased reactive oxygen species generation

    • Activation of mitochondrial unfolded protein response

To properly characterize these phenotypes, researchers should employ tissue-specific or inducible knockdown strategies to bypass early lethality that might result from complete loss of Tim17a2 function.

How can Tim17a2 be used to study evolutionarily conserved aspects of mitochondrial protein import?

Tim17a2 provides an excellent model for studying evolutionarily conserved mechanisms of mitochondrial protein import. Researchers can leverage this system through:

  • Comparative genomics: Aligning Tim17a2 sequences across species to identify conserved domains and species-specific adaptations.

  • Cross-species complementation: Testing whether human Tim17 homologs can rescue phenotypes in Drosophila Tim17a2 mutants, or vice versa.

  • Structure-function analysis: Creating chimeric proteins combining domains from different species to identify functionally critical regions.

  • Interactome mapping: Using techniques like BioID or co-immunoprecipitation to identify protein interaction partners and compare these networks across species.

This approach is particularly valuable as mitochondrial import machinery is highly conserved and many human mitochondrial diseases involve defects in protein import pathways. The use of Drosophila as a model organism allows for powerful genetic approaches that can identify novel components of these pathways .

What experimental approaches can reveal the interactome of Tim17a2?

Understanding the protein-protein interaction network of Tim17a2 is crucial for elucidating its function within the mitochondrial import machinery. Researchers can employ several complementary techniques:

  • Co-immunoprecipitation (Co-IP): Using antibodies against Tim17a2 or an epitope tag to pull down the protein complex, followed by mass spectrometry to identify interacting partners.

  • Proximity-dependent biotin identification (BioID): Fusing Tim17a2 to a biotin ligase to biotinylate proteins in close proximity, followed by streptavidin pulldown and mass spectrometry.

  • Yeast two-hybrid screening: Though challenging for membrane proteins, modified split-ubiquitin systems can be used to screen for direct interactors.

  • Genetic interaction screens: Performing genetic modifier screens in Drosophila to identify genes that enhance or suppress Tim17a2 mutant phenotypes .

  • Chemical crosslinking coupled with mass spectrometry: This approach can capture transient interactions within the native membrane environment.

The resulting interactome data can be organized in a network diagram with Tim17a2 at the center, connecting to various proteins involved in mitochondrial import, membrane organization, and quality control pathways.

What challenges are associated with studying Tim17a2 due to its genomic context?

Tim17a2 and related genes can present unique challenges for research due to their genomic context. Based on studies of Tim17b, which is located in heterochromatic regions of the Drosophila genome, researchers should be aware of:

  • Difficulties in genetic manipulation: Heterochromatic genes are often refractory to standard genetic approaches due to reduced recombination rates and complex chromatin structures .

  • Challenges in transgene construction: As observed with Tim17b, developing effective knockdown constructs for small heterochromatic genes requires careful design considerations .

  • Complex regulation: Genes in heterochromatic regions often have unique regulatory mechanisms that must be considered when designing expression constructs.

  • PCR amplification difficulties: Heterochromatic regions can be challenging to amplify accurately due to repetitive sequences and high GC content.

Researchers can address these challenges by:

  • Using specialized PCR protocols optimized for GC-rich templates

  • Carefully designing constructs that incorporate sufficient flanking sequences

  • Employing site-specific integration techniques for transgene insertion

  • Validating knockdown or knockout efficiency through multiple independent methods

What are the optimal conditions for expressing recombinant Tim17a2 in different systems?

Researchers have successfully expressed recombinant Tim17a2 in various systems, each with specific optimization requirements:

E. coli expression system:

  • Optimal strain: BL21(DE3) or C41/C43 for membrane proteins

  • Vector: pET series with His-tag for purification

  • Induction: 0.1-0.5 mM IPTG at lower temperatures (16-20°C)

  • Expression time: Extended expression (overnight) at reduced temperatures

  • Solubilization: Mild detergents like DDM or LDAO

Insect cell expression:

  • Baculovirus expression system using Sf9 or High Five cells

  • Addition of a secretion signal and/or fusion tags to improve folding

  • Harvesting: 48-72 hours post-infection

  • Membrane preparation: Gentle lysis followed by differential centrifugation

Yeast expression:

  • Pichia pastoris or Saccharomyces cerevisiae with strong inducible promoters

  • Growth in minimal media with appropriate carbon source

  • Induction protocols specific to the chosen promoter system

For any expression system, researchers should verify protein identity through Western blotting and mass spectrometry, and assess function through activity assays or structural studies.

How can researchers design effective Tim17a2 knockdown validation strategies?

When implementing Tim17a2 knockdown or knockout approaches, thorough validation is essential. A comprehensive validation strategy includes:

  • Molecular validation:

    • qRT-PCR to quantify mRNA reduction (target: >70% reduction)

    • Western blotting to confirm protein depletion

    • Genomic PCR to verify CRISPR-induced mutations

  • Functional validation:

    • Mitochondrial protein import assays using reporter constructs

    • Measurement of mitochondrial membrane potential

    • Assessment of mitochondrial morphology

  • Rescue experiments:

    • Re-expression of wild-type Tim17a2 to restore normal phenotype

    • Expression of related Tim17 proteins to test functional redundancy

    • Human ortholog expression to test evolutionary conservation

  • Controls:

    • Non-targeting RNAi or CRISPR constructs

    • Knockdown of unrelated genes

    • Tissue-specific controls to verify systemic effects

An example validation workflow is shown in Table 1:

Validation StepTechniqueExpected OutcomeTime Required
mRNA knockdownqRT-PCR>70% reduction2-3 days
Protein depletionWestern blot>70% reduction2-3 days
Mitochondrial importImport assay with reporter proteinsReduced matrix protein import1 week
Phenotypic analysisMicroscopy, development assaysTissue-specific defects1-2 weeks
Rescue experimentTransgene expressionPhenotype restoration2-3 weeks

How can Tim17a2 studies in Drosophila inform human mitochondrial disease research?

Drosophila Tim17a2 studies provide valuable insights into human mitochondrial diseases through several approaches:

  • Model system for mitochondrial disorders: Many human mitochondrial diseases involve defects in protein import machinery. Drosophila Tim17a2 models can help elucidate the fundamental mechanisms disrupted in these conditions .

  • Forward genetic screens: Using Drosophila eye degeneration or other phenotypes as readouts, researchers can conduct genetic screens to identify modifiers of Tim17a2-related pathologies, potentially uncovering novel therapeutic targets .

  • Testing human disease variants: Researchers can introduce human disease-associated mutations into Drosophila Tim17a2 to assess their functional consequences in an in vivo context.

  • Drug screening platforms: Drosophila models with Tim17a2 disruption can serve as platforms for screening compounds that might rescue mitochondrial import defects.

The experimental evolution approach described in search result could be adapted to study compensatory mechanisms that emerge when Tim17a2 function is compromised, potentially revealing resilience pathways that could be therapeutically targeted in human disease.

What specialized experimental techniques are most valuable for Tim17a2 functional studies?

Several specialized techniques have proven particularly valuable for studying Tim17a2 and related proteins:

  • In vitro protein import assays:

    • Isolation of mitochondria from cells with normal or altered Tim17a2 levels

    • Preparation of radiolabeled or fluorescently labeled precursor proteins

    • Incubation of precursors with isolated mitochondria

    • Analysis of import efficiency through SDS-PAGE and autoradiography or fluorescence detection

  • Blue native PAGE (BN-PAGE):

    • Gentle solubilization of mitochondrial membranes with digitonin

    • Separation of intact protein complexes by native electrophoresis

    • Detection of Tim17a2-containing complexes by Western blotting

    • Assessment of complex assembly/stability in various genetic backgrounds

  • Fluorescence Recovery After Photobleaching (FRAP):

    • Expression of fluorescently tagged Tim17a2

    • Selective photobleaching of mitochondrial regions

    • Time-lapse imaging to monitor fluorescence recovery

    • Quantitative analysis of protein dynamics and membrane integration

  • Electron microscopy:

    • Ultrastructural analysis of mitochondrial morphology

    • Immunogold labeling to precisely localize Tim17a2

    • Tomography to visualize protein import sites in 3D

These techniques, combined with the genetic tools available in Drosophila, provide a powerful integrated approach for understanding Tim17a2 function in its native context.

What are the emerging technologies that could advance Tim17a2 research?

Several cutting-edge technologies show promise for advancing Tim17a2 research:

  • Cryo-electron microscopy (cryo-EM): As membrane protein structural biology advances, cryo-EM could reveal the detailed structure of Tim17a2 alone or in complex with other translocase components.

  • Single-molecule imaging techniques: These approaches can provide insights into the dynamics of individual Tim17a2 molecules within living cells.

  • Genome-wide CRISPR screens: Systematic screening for genes that interact with Tim17a2 could reveal novel components of mitochondrial import pathways.

  • Tissue-specific proteomics: Advances in proteomics sensitivity now enable analysis of tissue-specific changes in the mitochondrial proteome resulting from Tim17a2 manipulation.

  • Organoid models: Developing Drosophila organoid systems could provide more physiologically relevant contexts for studying Tim17a2 function in specific tissues.

  • Computational protein structure prediction: Tools like AlphaFold2 can generate increasingly accurate structural models of Tim17a2 and its interactions, guiding experimental design.

  • Nanobody development: Developing specific nanobodies against Tim17a2 could enable new approaches for tracking and manipulating the protein in living systems.

These technologies, combined with established Drosophila genetic approaches, will likely drive significant advances in understanding Tim17a2 biology in the coming years.

What are the unresolved questions regarding Tim17a2 function and regulation?

Despite progress in understanding Tim17a2 and related proteins, several important questions remain unresolved:

  • Substrate specificity: How does Tim17a2 contribute to the selectivity of protein import? Does it recognize specific features of imported proteins?

  • Regulatory mechanisms: How is Tim17a2 expression and activity regulated in response to cellular stress, metabolic changes, or developmental signals?

  • Functional redundancy: What is the degree of functional overlap between Tim17a2 and other Tim17 family members in Drosophila?

  • Post-translational modifications: Are there key modifications that regulate Tim17a2 function or stability?

  • Evolutionary specialization: How has Tim17a2 function diverged across species, and what can this tell us about specialized mitochondrial import requirements?

  • Disease relevance: Are there human diseases specifically associated with mutations in Tim17 homologs, and can Drosophila models recapitulate these conditions?

  • Assembly pathway: What is the sequence of events and chaperones involved in the proper folding and membrane insertion of Tim17a2?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.