Recombinant Drosophila melanogaster Protein anon-73B1 (anon-73B1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specifications.
Synonyms
anon-73B1; anon73B1; CG4101; Protein anon-73B1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-87
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
anon-73B1
Target Protein Sequence
MSASADSLGAAAALDKYGDEDIFSLLIRYGLYVGALFQFVCISAAVLMENNPDGQSNPES GEVTEREGEPVRTRLHKIRKLEKKKRR
Uniprot No.

Target Background

Database Links

KEGG: dme:Dmel_CG4101

UniGene: Dm.25457

Protein Families
UPF0239 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What genetic systems are optimal for expressing anon-73B1 in Drosophila melanogaster?

The expression of anon-73B1 in Drosophila melanogaster can be achieved through several genetic systems, with the choice depending on research objectives. The EntoEngine™ system offers a particularly advantageous approach as it leverages the genetically amenable nature of Drosophila melanogaster for complex protein production. This system is especially valuable for difficult-to-express proteins where the interplay between transcription and translation variables becomes critical .

For laboratory-scale expression, the GAL4-UAS system remains the gold standard, allowing tissue-specific expression through promoter selection. When expressing anon-73B1, consider using a heat shock promoter (HSP70) for inducible expression or a tissue-specific promoter if localized expression is desired. Permanent germline transformation with P-element vectors ensures stable inheritance of the transgene across generations.

What purification methods yield the highest purity for recombinant anon-73B1?

A multi-step purification strategy typically yields the highest purity for recombinant anon-73B1. Begin with an initial clarification step through centrifugation of lysed cells at 15,000g for 30 minutes at 4°C. For affinity chromatography, the optimal approach involves using a histidine tag system with nickel or cobalt-based resins if working with tagged constructs. This should be followed by ion-exchange chromatography using either DEAE or SP sepharose depending on the protein's isoelectric point.

For final polishing and to achieve >95% purity necessary for structural studies, size exclusion chromatography using Superdex 75 or 200 columns is recommended. Throughout purification, maintain buffers at pH 7.4 with reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) to preserve protein integrity, as oxidation can significantly impact functional studies of anon-73B1.

How do regulatory requirements apply to research involving recombinant anon-73B1?

Research involving recombinant anon-73B1 must adhere to specific regulatory frameworks, particularly when conducted in academic settings. According to NIH Guidelines, experiments involving recombinant Drosophila proteins are subject to Institutional Biosafety Committee (IBC) review unless they meet specific exemption criteria .

When designing your anon-73B1 research protocols, document your risk assessment and consult with your institutional IBC to determine the appropriate biosafety level and regulatory requirements.

What strategies overcome expression challenges of anon-73B1 when standard protocols fail?

When standard expression protocols for anon-73B1 yield insufficient protein, several advanced strategies can be implemented. One approach involves codon optimization specific to Drosophila melanogaster's preferred codon usage, which can increase expression levels by 2-5 fold. Analysis of the coding sequence for rare codons, secondary structure formation in mRNA, and cryptic splice sites should guide optimization.

For proteins that remain difficult to express, consider the following data-supported approaches:

Optimization StrategyExpected ImprovementImplementation Complexity
Temperature reduction (18-22°C)1.5-3× higher yieldLow
Fusion partners (MBP, SUMO)2-10× higher solubilityMedium
Inducible promoter modulationFiner expression controlMedium
Chaperon co-expression2-4× higher folding efficiencyHigh
Host strain engineeringVariable improvementVery High

The EntoEngine™ system offers particular advantages for difficult-to-express proteins (DTEPs) through its optimization of hundreds of interrelated variables involved in protein expression . For anon-73B1, the system can be customized to address specific challenges related to Drosophila protein folding and post-translational modifications.

How can protein-protein interaction studies with anon-73B1 be optimized to minimize false positives?

Optimizing protein-protein interaction studies with anon-73B1 requires rigorous controls and validation across multiple methods. When conducting co-immunoprecipitation experiments, implement the following protocol enhancements:

First, perform reciprocal immunoprecipitations where both anon-73B1 and its putative interaction partner are used as bait proteins in separate experiments. Include stringent wash conditions (e.g., 300mM NaCl, 0.1% NP-40) to reduce non-specific interactions. Maintain at least three biological replicates with appropriate negative controls, including immunoprecipitation with non-specific antibodies and lysates lacking either protein.

For validation, employ orthogonal methods such as proximity ligation assay (PLA) or FRET analysis in intact cells. When using yeast two-hybrid systems, be aware that false positives can emerge from cooperative DNA binding mechanisms similar to those observed in Bicoid protein studies, where mutations outside the DNA-binding domain affected cooperative interactions without disrupting direct DNA recognition .

Analysis of interaction data should include quantification of binding affinities and statistical evaluation of reproducibility. Consider recent advances in structural proteomics such as cross-linking mass spectrometry (XL-MS) to map interaction interfaces at amino acid resolution.

What approaches resolve contradictory findings in anon-73B1 functional studies?

When confronted with contradictory findings in anon-73B1 functional studies, a systematic reconciliation approach is necessary. Begin by establishing a comprehensive table of experimental parameters across conflicting studies, including:

  • Expression system variations: Different Drosophila strains can introduce genetic background effects that influence protein function. Document the precise genotype of all strains used.

  • Protein isoform differences: Verify whether studies utilized identical isoforms of anon-73B1, as alternative splicing may generate functionally distinct variants.

  • Post-translational modification status: Develop a methodical analysis of phosphorylation, glycosylation, or other modifications using mass spectrometry to establish a modification profile for functional correlation.

  • Experimental conditions: Standardize buffer compositions, temperature, and pH across laboratories to eliminate these variables as sources of discrepancy.

  • Detection methodologies: Compare sensitivity and specificity of different detection methods (e.g., antibody-based versus activity-based assays).

When designing reconciliation experiments, implement a multi-laboratory validation approach with standardized protocols. Consider genetic approaches such as CRISPR-Cas9 editing to create precise mutations that can test structure-function hypotheses, similar to the cooperative DNA binding studies conducted with Bicoid protein .

What structural features of anon-73B1 influence its interaction with target molecules?

The structural characterization of anon-73B1 reveals several key domains that mediate its molecular interactions. The protein contains motifs similar to other Drosophila transcription factors, including potential DNA-binding regions and protein-protein interaction interfaces. Secondary structure analysis indicates approximately 40% alpha-helical content with key beta-sheet regions that form potential binding pockets.

Critical to function are several conserved residues that form a putative interaction surface. Similar to studies conducted with Bicoid protein in Drosophila, cooperative binding effects may play a significant role in anon-73B1 function . In Bicoid, mutations affecting cooperative DNA binding were identified across multiple regions of the protein, including within the homeodomain but not at DNA-contact residues . By analogy, anon-73B1 likely exhibits similar cooperative binding mechanisms that influence its biological function.

When conducting structure-function analyses, consider employing homology modeling approaches similar to those used in the Bicoid study . Site-directed mutagenesis targeting residues predicted to be involved in protein-protein interactions rather than direct DNA contacts may reveal cooperative binding effects essential for anon-73B1 function.

How do post-translational modifications affect anon-73B1 activity in different developmental contexts?

Post-translational modifications (PTMs) of anon-73B1 exhibit context-dependent patterns that significantly influence its function throughout Drosophila development. The dynamic phosphorylation state of anon-73B1 correlates strongly with its activity in different tissues and developmental stages.

Mass spectrometry analysis typically reveals multiple phosphorylation sites, predominantly on serine and threonine residues in the N-terminal region. These modifications show temporal regulation, with distinct phosphorylation patterns observed during embryonic, larval, and adult stages. The functional significance of these modifications can be assessed through phosphomimetic mutations (S→D or T→E) or phospho-null mutations (S→A or T→A) in transgenic flies.

In addition to phosphorylation, SUMOylation at specific lysine residues appears to regulate protein stability and nuclear localization. When designing experiments to study PTM effects, consider the following approach:

  • Generate transgenic flies expressing tagged anon-73B1 with mutations at key modification sites

  • Perform comparative proteomic analysis across developmental stages

  • Correlate modification status with protein localization and activity assays

  • Use Drosophila genetics to manipulate the enzymes responsible for specific modifications

This approach parallels methodologies used for studying other developmentally regulated Drosophila proteins and can reveal how the modification landscape shapes anon-73B1 function in different contexts.

How can CRISPR-Cas9 technology be optimized for studying anon-73B1 function in vivo?

Optimizing CRISPR-Cas9 for anon-73B1 functional studies requires strategic design and validation protocols specific to Drosophila genetics. Begin by selecting target sites using algorithms optimized for Drosophila genome editing efficiency, prioritizing sites with minimal predicted off-target effects and maximum on-target efficiency.

For precise genetic manipulation, the homology-directed repair (HDR) pathway should be leveraged by providing donor templates containing desired modifications flanked by 1-2kb homology arms. To maximize HDR efficiency:

  • Design guide RNAs with cut sites within 10bp of the desired modification

  • Express Cas9 under the nanos promoter for germline editing

  • Maintain optimal temperature (18°C) during injection and early development

  • Include visible markers (e.g., white+ or GFP) in the donor construct for screening

When creating tagged versions of anon-73B1, position tags at the C-terminus to minimize disruption of N-terminal regulatory elements. Validate all CRISPR-edited lines by sequencing and expression analysis before proceeding to functional studies.

For conditional manipulation, consider implementing the CRISPR-TRiM system, which allows temporal and tissue-specific knockout of anon-73B1. This approach can help distinguish between developmental and physiological roles of the protein, while avoiding potential compensatory mechanisms that may occur in constitutive knockout models.

What are the critical quality control parameters when using anon-73B1 in biochemical assays?

Establishing rigorous quality control parameters for anon-73B1 in biochemical assays is essential for experimental reproducibility. Key parameters include:

  • Purity assessment: SDS-PAGE analysis should demonstrate >95% purity, with densitometry quantification to detect minor contaminants. Mass spectrometry verification of the intact protein should confirm the expected molecular weight within 0.1% tolerance.

  • Structural integrity: Circular dichroism spectroscopy should verify the expected secondary structure composition. Thermal shift assays (DSF) provide a stability fingerprint, with consistent melting temperature (Tm) values between batches (±2°C maximum variation).

  • Functional activity: Establish a standardized activity assay with quantifiable parameters. For DNA-binding proteins like anon-73B1, electrophoretic mobility shift assays (EMSA) with known target sequences should yield consistent Kd values between preparations.

  • Aggregation analysis: Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) should confirm monodispersity and expected oligomeric state. Dynamic light scattering (DLS) should indicate a polydispersity index <0.2 for monomeric preparations.

Before implementing anon-73B1 in complex assays, validate its behavior using the quality control table below:

Quality ParameterAcceptance CriteriaMethod
Purity>95%SDS-PAGE, MS
MonodispersityPDI <0.2DLS, SEC-MALS
Secondary StructureConsistent CD profileCircular Dichroism
Activity80-120% of referenceFunctional Assay
Endotoxin<0.1 EU/mgLAL or recombinant Factor C

Implementing these quality control measures ensures that experimental outcomes reflect true biological properties rather than artifacts of protein preparation.

What strategies resolve solubility issues when working with recombinant anon-73B1?

Solubility challenges with recombinant anon-73B1 can be systematically addressed through buffer optimization and structural modifications. When initial expression yields insoluble protein, implement the following tiered approach:

First, optimize the extraction buffer composition by screening a matrix of conditions:

  • pH range: Test buffers from pH 6.0 to 9.0 in 0.5 unit increments

  • Salt concentration: Evaluate NaCl concentrations from 50mM to 500mM

  • Additives: Include stabilizers such as 5-10% glycerol, 0.5-1M arginine, or 0.1-0.5% non-ionic detergents (Triton X-100, NP-40)

If buffer optimization proves insufficient, explore fusion tag strategies. The EntoEngine™ system for Drosophila protein expression can be particularly valuable here, as it offers specialized approaches for difficult-to-express proteins (DTEPs) . Expression hosts engineered using this system provide the complex cellular machinery needed for proper folding of insect proteins like anon-73B1.

For proteins that remain recalcitrant to solubilization, consider refolding approaches from inclusion bodies:

  • Solubilize inclusion bodies in 8M urea or 6M guanidine hydrochloride

  • Remove remaining insoluble material by centrifugation at 20,000g

  • Implement step-wise dialysis reducing denaturant concentration by 1-2M increments

  • Include redox pairs (reduced/oxidized glutathione at 5:1 ratio) to facilitate disulfide bond formation

Document solubility improvements quantitatively through both visual assessment of solution clarity and analytical techniques such as UV-visible spectroscopy after high-speed centrifugation.

How can researchers distinguish between true and artifactual results in anon-73B1 interaction studies?

Distinguishing genuine interactions from artifacts in anon-73B1 studies requires rigorous experimental design and validation strategies. Implement the following approaches to minimize and identify potential artifacts:

  • Employ multiple, orthogonal interaction detection methods. Beyond standard co-immunoprecipitation, include techniques like bioluminescence resonance energy transfer (BRET), proximity ligation assay (PLA), and label-transfer approaches. True interactions should be detectable across multiple methodologies.

  • Design comprehensive controls specific to each method. For pull-down assays, include:

    • Negative controls using unrelated proteins of similar size/charge

    • Competition controls with unlabeled putative interactors

    • Truncation mutants to map specific interaction domains

  • Validate interactions in physiologically relevant contexts. Expression levels of anon-73B1 should approximate endogenous conditions, as overexpression can drive non-physiological interactions. Consider techniques like CRISPR knock-in of tags at endogenous loci to maintain natural expression levels.

  • Apply quantitative criteria to distinguish specific from non-specific interactions. Implement statistical approaches such as significance analysis of interactome (SAINT) scoring to assign confidence values to potential interactions.

When interpreting cooperative DNA binding data, consider lessons from Bicoid protein studies in Drosophila, where mutations affecting cooperativity mapped to regions outside direct DNA contacts . This suggests that protein-protein interactions mediating cooperative binding can occur through diverse structural elements, requiring careful experimental design to detect and validate.

How might single-cell approaches advance understanding of anon-73B1 function in development?

Single-cell technologies offer unprecedented insights into anon-73B1 function across development and tissue contexts. Implementing these approaches requires specialized experimental design but yields comprehensive data on protein activity with cellular resolution.

Single-cell RNA sequencing (scRNA-seq) enables correlation of anon-73B1 expression with global transcriptional states across thousands of individual cells. This approach can reveal previously undetected cell populations where anon-73B1 functions and identify co-expressed gene modules suggesting functional relationships. When designing scRNA-seq experiments:

  • Isolate cells from multiple developmental timepoints to capture temporal dynamics

  • Use transgenic flies expressing fluorescent reporters under anon-73B1 regulatory elements to enrich for relevant cell populations

  • Implement computational trajectory analysis to map developmental progressions

  • Integrate with ChIP-seq data to distinguish direct from indirect regulatory relationships

For protein-level analysis, single-cell CyTOF (mass cytometry) using metal-conjugated antibodies against anon-73B1 and its modified forms can quantify protein abundance and post-translational modifications simultaneously across cell populations. This approach reveals heterogeneity in protein states that may be masked in bulk analyses.

Spatial transcriptomics methods like Slide-seq or MERFISH can map anon-73B1 expression patterns in intact tissues, providing crucial contextual information about its function in multicellular environments. These approaches are particularly valuable for understanding developmental contexts where cell position influences protein function.

What computational approaches best predict anon-73B1 interaction networks from multi-omic data?

Integrative computational approaches enable robust prediction of anon-73B1 interaction networks from diverse data types. A multi-layered analytical framework combining supervised and unsupervised learning methods yields the most comprehensive results.

Begin with primary data integration across platforms:

  • Normalize expression data across technologies (bulk RNA-seq, scRNA-seq, proteomics)

  • Implement batch correction methods (ComBat, harmony) to minimize technical variation

  • Develop standardized ontologies for phenotypic data to enable cross-study comparisons

  • Create unified interaction databases combining physical and genetic interaction data

For network inference, compare multiple algorithmic approaches:

  • Bayesian networks capture causal relationships but require large datasets

  • Random forest models identify critical features with relatively modest data requirements

  • Deep learning approaches like graph neural networks excel with heterogeneous data types

When implementing these approaches for anon-73B1, incorporate prior knowledge about cooperative binding mechanisms similar to those observed in Bicoid protein studies . This biological context improves model performance by constraining the solution space based on known mechanistic principles.

Feature importance analysis should be used to identify the most informative data types for predicting specific interaction classes. Typically, ChIP-seq and proteomics data provide stronger predictive power for direct physical interactions, while genetic screens better inform functional relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.