Recombinant Drosophila melanogaster Protein Kr-h2 (Kr-h2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to meet specific requirements.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
Kr-h2; CG9159; Krueppel homolog 2; Protein Kr-h2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Kr-h2
Target Protein Sequence
MSAPTDQPPRSEGAQTNSSERSSQQQEQPQQSQSQNVPAKLLQHFQTNRIDSALWALRLL VIFFTVSYVLPIFTSQQSAFSKVMLANAAISALRLHQRLPAFAFSREFLARLFAEDSCHY MMYSLIFFNIRPSLLVLIPVLLYSVLHASSYSLKLLDLIGQNSWWGARFIISIVEFQAAN ILKATAFCEIFIMPYAIVLAFMNHAGLMTPVIYYHYLVMRYSSRRNPYPRNAFAELRITF EALAARSPPAFAKIIRGGIGFVNRLAPQLQPAAAQE
Uniprot No.

Target Background

Function
A member of a dosage-dependent hierarchy with effects on white gene expression.
Database Links

KEGG: dme:Dmel_CG9159

STRING: 7227.FBpp0078823

UniGene: Dm.323

Protein Families
PER33/POM33 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Kr-h2 and how is it classified within the Drosophila genome?

Kr-h2 (Kruppel homolog 2) is a protein-coding gene in Drosophila melanogaster, also known by several synonyms including CG9159, Dmel\CG9159, Kr-H2, Kr-h, and anon-26Ba . It belongs to the Krüppel family of genes, which are critical transcription factors involved in embryonic development. While the canonical Krüppel (Kr) protein functions as a gap gene product during early embryogenesis, Kr-h2 is a homolog that likely serves related but distinct developmental functions . The gene is located on the X chromosome of Drosophila melanogaster and encodes a protein containing zinc finger DNA-binding domains characteristic of this transcription factor family.

How does Kr-h2 differ from the canonical Krüppel (Kr) protein?

While both Kr-h2 and the canonical Krüppel (Kr) protein belong to the same family of transcription factors, they differ in several key aspects:

  • Expression patterns: The canonical Kr protein shows a specific nuclear staining pattern during early embryogenesis, representing subpatterns of Kr transcript accumulation in particular tissues . Kr-h2, as a homolog, likely has distinct spatial and temporal expression patterns.

  • Developmental roles: Kr functions as a primary gap gene product essential for proper body segmentation during embryogenesis . Kr-h2, while related, may have evolved specialized functions in different developmental contexts.

  • Genetic location: While Kr-h2 is located on the X chromosome , the genetic location of canonical Kr differs, contributing to their distinct regulation and inheritance patterns.

Understanding these differences is crucial for researchers designing experiments to specifically target Kr-h2 without interfering with canonical Kr functions.

What are the recommended approaches for cloning and expressing recombinant Kr-h2 protein?

For successful expression of recombinant Kr-h2 protein, researchers should consider the following methodological approach:

  • Gene synthesis or PCR amplification: The Kr-h2 gene (CG9159) can be amplified from Drosophila genomic DNA or cDNA libraries. Commercial gene synthesis is also available, with verified sequences starting from standardized pricing structures .

  • Vector selection: Choose expression vectors with appropriate promoters and fusion tags (His, GST, or MBP) to facilitate purification and enhance solubility.

  • Expression systems:

    • Bacterial systems (E. coli): Cost-effective but may lack post-translational modifications

    • Insect cell systems (Sf9, S2): More suitable for functional studies requiring proper folding

    • Cell-free systems: For rapid screening of expression conditions

  • Purification strategy: Implement multi-step purification including affinity chromatography followed by size exclusion or ion exchange chromatography to achieve high purity.

  • Validation: Confirm protein identity using mass spectrometry and functionality through DNA-binding assays.

This methodological approach ensures production of functional recombinant Kr-h2 protein suitable for subsequent biochemical and structural studies.

What genetic tools are available for studying Kr-h2 function in Drosophila?

Several genetic approaches can be employed to study Kr-h2 function in vivo:

  • Balancer chromosomes: Since Kr-h2 is located on the X chromosome, FM7-series balancers (FM7a, FM7c) are particularly useful for maintaining Kr-h2 mutations . These balancer chromosomes contain multiple inversions that suppress recombination, including:

    • In(1)sc

    • In(1)dl-49

    • In(1)FM6

  • CRISPR/Cas9 genome editing: For generating precise mutations or tagging the endogenous Kr-h2 locus.

  • GAL4/UAS system: For tissue-specific overexpression or knockdown studies.

  • FLP/FRT system: For generating mosaic animals to study cell-autonomous functions.

  • RNAi lines: For conditional knockdown experiments.

When using FM7 balancers, researchers should be aware that rare recombination events can occur on historical timescales, potentially leading to sequence variations among balancer chromosomes . Periodic verification of balancer chromosome sequences is recommended for long-term studies.

How can I detect and visualize Kr-h2 expression patterns during development?

To analyze Kr-h2 expression patterns during Drosophila development, researchers can employ methodologies similar to those used for studying the canonical Krüppel protein:

  • Immunohistochemistry: Using antibodies directed against Kr-h2 to reveal patterns of nuclear staining that represent tissue-specific expression . This approach requires:

    • Generation of specific antibodies against Kr-h2

    • Fixation and permeabilization of embryos or tissues

    • Appropriate controls to distinguish Kr-h2 from related Krüppel proteins

  • RNA in situ hybridization: To visualize Kr-h2 transcript accumulation in specific tissues.

  • Reporter gene constructs: Creating transgenic flies with Kr-h2 regulatory regions driving fluorescent protein expression.

  • Live imaging: For dynamic visualization of Kr-h2 expression during developmental processes.

These complementary approaches can reveal how Kr-h2 expression changes throughout development and across different tissues, providing insights into its developmental roles.

How can we investigate potential functional redundancy between Kr-h2 and other Krüppel family proteins?

Investigating functional redundancy requires sophisticated genetic and molecular approaches:

Experimental ApproachMethodologyExpected Outcome
Double mutant analysisGenerate flies carrying mutations in both Kr-h2 and related genes (e.g., canonical Kr)Enhanced phenotypes would suggest partial redundancy
Domain swap experimentsCreate chimeric proteins containing domains from Kr-h2 and KrIdentify which domains confer specific functions
Rescue experimentsExpress Kr-h2 in Kr mutant backgrounds and vice versaDetermine if one protein can compensate for the other
ChIP-seq comparisonIdentify genomic binding sites for both proteinsOverlapping binding profiles would suggest shared targets
Transcriptome analysisCompare gene expression changes in single and double mutantsIdentify uniquely and commonly regulated genes

This multi-faceted approach can reveal the extent of functional overlap between Kr-h2 and other Krüppel family members, providing insights into the evolution of this transcription factor family.

What is known about Kr-h2's role in Drosophila as a model for human disease research?

Drosophila melanogaster has emerged as a valuable model for investigating human biology, with 75% of human disease-related genes having fly homologs . For Kr-h2 research with translational potential:

  • Identify human orthologs of Kr-h2 through comparative genomics and determine if these orthologs are associated with human diseases.

  • Utilize Drosophila's genetic tractability to:

    • Model disease-associated mutations in conserved domains

    • Screen for genetic interactions that modify disease phenotypes

    • Test potential therapeutic interventions

  • Leverage Drosophila's simple endogenous microbial community to study how Kr-h2 might influence host-microbe interactions, which could have implications for human health .

  • Apply high-throughput screening approaches to identify small molecules that modulate Kr-h2 activity, potentially revealing new therapeutic targets.

This translational approach maximizes the value of Drosophila as a model organism while maintaining focus on clinically relevant questions.

What are common challenges in generating and maintaining Kr-h2 mutant fly lines?

Researchers working with Kr-h2 mutants should be aware of several challenges:

  • Balancer chromosome instability: Research on FM7 balancers has shown that rare double-crossover events can occur within inversions, potentially leading to sequence divergence among balancer chromosomes used to maintain mutations . For X-chromosome genes like Kr-h2, it's particularly important to:

    • Periodically verify the genotype of stocks

    • Maintain multiple independent copies of valuable stocks

    • Be cautious when interpreting phenotypic differences that might arise from balancer chromosome variations

  • Phenotypic assessment: Because Kr-h2 may have subtle developmental effects compared to canonical Kr, careful phenotypic analysis is necessary, including:

    • Quantitative assessment of developmental timing

    • Detailed morphological examination

    • Molecular readouts of downstream gene expression

  • Genetic background effects: When using balancer chromosomes like FM7c, researchers should be aware that:

    • Approximately 13% of stocks carrying FM7c showed reversion of the female-sterile singed (sn) allele due to double crossover events

    • Such events may affect interpretation of experiments if not properly controlled

Careful stock maintenance and regular genotypic verification are essential for robust Kr-h2 research.

How should researchers address potential off-target effects when using RNAi to knockdown Kr-h2?

When using RNAi to study Kr-h2 function, researchers must address several methodological concerns:

  • Sequence similarity: Due to the homology between Kr-h2 and other Krüppel family members, carefully design RNAi constructs to ensure specificity.

  • Validation approaches:

    • Use multiple independent RNAi constructs targeting different regions of Kr-h2

    • Quantify knockdown efficiency through qRT-PCR and Western blotting

    • Perform rescue experiments with RNAi-resistant Kr-h2 constructs

    • Check expression of closely related genes to rule out off-target effects

  • Tissue-specific considerations: When using GAL4 drivers to express RNAi in specific tissues, confirm that:

    • The GAL4 expression pattern matches the endogenous Kr-h2 expression domain

    • Control for potential developmental delays caused by the GAL4/UAS system itself

These methodological precautions ensure that phenotypes can be confidently attributed to specific reduction of Kr-h2 function rather than experimental artifacts.

How might new genomic technologies advance our understanding of Kr-h2 function?

Emerging technologies offer new opportunities for Kr-h2 research:

  • Single-cell transcriptomics: Resolve cell type-specific effects of Kr-h2 perturbation with unprecedented resolution.

  • Spatial transcriptomics: Map Kr-h2-dependent gene expression changes while preserving spatial information within tissues.

  • CUT&Tag/CUT&RUN: Precisely map Kr-h2 binding sites with improved efficiency compared to traditional ChIP-seq.

  • Long-read sequencing: Better characterize complex genomic rearrangements in Kr-h2 mutants or chromosome balancers.

  • Cryo-EM: Determine the structure of Kr-h2 protein complexes at near-atomic resolution.

These technologies, when applied to Kr-h2 research, could reveal new aspects of its function in gene regulation and development that were previously inaccessible with traditional approaches.

What are promising approaches for studying Kr-h2 in the context of Drosophila models of human disease?

Building on Drosophila's value as a model organism for human disease research , several promising approaches for studying Kr-h2 include:

  • Creating "humanized" flies expressing human orthologs of Kr-h2 to directly study the function of human variants.

  • Establishing disease-relevant readouts for Kr-h2 function, such as:

    • Neuronal development and function

    • Immune response to pathogens

    • Metabolic regulation

  • Using Drosophila's potential for high-throughput screening to:

    • Identify genetic modifiers of Kr-h2-associated phenotypes

    • Discover small molecules that interact with Kr-h2 or its signaling pathways

    • Test candidate therapeutic approaches

  • Leveraging Drosophila's amenability to infection studies to investigate how Kr-h2 might influence host-pathogen interactions, building on established protocols for studying polymicrobial infections in flies .

These approaches maximize the translational potential of Kr-h2 research in Drosophila while maintaining scientific rigor and experimental tractability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.