Recombinant Drosophila melanogaster Protein KRTCAP2 homolog (CG31460)

Shipped with Ice Packs
In Stock

Description

Comparison with Homologs

The KRTCAP2 homolog in Drosophila melanogaster shares significant sequence similarity with counterparts in other Drosophila species, such as Drosophila pseudoobscura pseudoobscura, which has a protein known as GA16263 . This conservation suggests important functional roles that have been maintained throughout evolutionary history.

SpeciesProtein NameGene IDAmino Acid LengthSimilarity
Drosophila melanogasterKRTCAP2 homologCG31460141 aaReference
Drosophila pseudoobscuraKRTCAP2 homologGA16263140 aaHigh similarity

The high degree of conservation between these homologs indicates evolutionary pressure to maintain the protein's structure and function, highlighting its biological importance across different insect species .

Functional Roles and Biological Significance

The Recombinant Drosophila melanogaster Protein KRTCAP2 homolog (CG31460) serves as a critical subunit of the oligosaccharyl transferase (OST) complex, which plays a central role in protein N-glycosylation . This complex catalyzes the initial and rate-limiting step in the N-glycosylation pathway, transferring a predefined glycan (Glc₃Man₉GlcNAc₂ in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains .

The N-glycosylation process occurs co-translationally as proteins are being synthesized and transported across the endoplasmic reticulum membrane. The OST complex, including the KRTCAP2 homolog, associates with the Sec61 complex at the channel-forming translocon complex that facilitates protein translocation across the ER membrane . This strategic positioning ensures that N-glycosylation can occur efficiently as the nascent polypeptide emerges into the ER lumen.

Role in Cellular Processes

N-glycosylation mediated by the OST complex containing the KRTCAP2 homolog is essential for:

  1. Proper protein folding in the endoplasmic reticulum

  2. Protein quality control mechanisms

  3. Protein targeting and trafficking

  4. Cell-cell communication and recognition

  5. Immune system function

Disruptions in N-glycosylation pathways can lead to severe developmental abnormalities and diseases, underscoring the importance of this process and the proteins involved in it.

Recombinant Production and Research Applications

The recombinant form of Drosophila melanogaster Protein KRTCAP2 homolog has been successfully produced in various expression systems. This achievement has facilitated detailed studies of the protein's structure, function, and interactions.

Expression Systems

The protein has been expressed in multiple host systems, providing researchers with flexibility in production based on specific experimental requirements :

Expression SystemAdvantagesApplications
Cell-Free ExpressionRapid production, avoids cellular toxicityInitial screening, structural studies
E. coliHigh yield, cost-effectiveFunctional assays, antibody production
YeastPost-translational modificationsInteraction studies
BaculovirusInsect-derived modificationsComplex formation studies
Mammalian CellMost authentic modificationsAdvanced functional studies

The recombinant protein typically achieves a purity level of greater than or equal to 85% as determined by SDS-PAGE analysis, making it suitable for most research applications .

Research Tools and Resources

In addition to the recombinant protein itself, several research tools have been developed to facilitate studies of the KRTCAP2 homolog:

  1. Plasmid resources: The gene is available in plasmid form (e.g., plasmid ID 34169 from Addgene)

  2. Antibodies: Rabbit polyclonal antibodies against the Drosophila melanogaster CG31460 protein are commercially available and have been validated for applications such as ELISA and Western blotting

These resources have enabled researchers to investigate the protein's expression patterns, localization, interactions, and functions in various experimental contexts.

Research Significance and Future Directions

The recombinant Drosophila melanogaster Protein KRTCAP2 homolog (CG31460) represents an important tool for investigating fundamental aspects of protein N-glycosylation and the function of the oligosaccharyl transferase complex. As a component of a complex that performs the initial and rate-limiting step in N-glycosylation, this protein contributes to a process that is essential for proper protein folding, quality control, and function.

Understanding the structure-function relationships of this protein could provide insights into diseases associated with defects in N-glycosylation, collectively known as congenital disorders of glycosylation (CDGs). While the search results don't directly link the KRTCAP2 homolog to specific diseases, its fundamental role in N-glycosylation suggests potential relevance to these conditions.

Future research directions may include:

  1. Detailed structural analysis using X-ray crystallography or cryo-electron microscopy

  2. Investigation of protein-protein interactions within the OST complex

  3. Functional studies using CRISPR-Cas9 gene editing to create precise mutations

  4. Exploration of the protein's role in developmental processes using Drosophila as a model organism

  5. Comparative studies across species to understand evolutionary conservation and divergence

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order and we will do our best to fulfill it.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please communicate this to us and we will prioritize developing the specified tag.
Synonyms
CG31460; Protein KRTCAP2 homolog; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2; Oligosaccharyl transferase subunit KCP2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG31460
Target Protein Sequence
MSASVSSKSTVVSSIISGLLSIVLFGTLRFCSEWFNDSQLRVLLGGYLFSWVFILSLTCV SNAEMVVFGQDFQAKLLPEIIFCLSLTVAAAGLVHRVCATTSVLFSLVGLYFLNRISTKY YSVQVPSVDAPTTRKGGKKFK
Uniprot No.

Target Background

Function
This protein serves as a subunit of the oligosaccharyl transferase (OST) complex. The complex catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This step is the first in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that facilitates protein translocation across the endoplasmic reticulum (ER). All subunits are essential for maximal enzyme activity.
Database Links
Protein Families
KRTCAP2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the KRTCAP2 homolog (CG31460) in Drosophila melanogaster?

The KRTCAP2 homolog (CG31460) in Drosophila melanogaster is a protein that shares sequence similarity with the human Keratinocyte-associated protein 2 (KRTCAP2). Similar to other membrane proteins in Drosophila, it likely plays roles in cellular signaling pathways. While specific function remains under investigation, research suggests potential involvement in protein trafficking and membrane organization, similar to the Drosophila Trp family of proteins which are involved in calcium signaling pathways . Expression studies indicate presence in multiple tissues during development, suggesting diverse functional roles throughout the Drosophila life cycle.

What expression systems are most effective for recombinant production of Drosophila KRTCAP2 homolog?

Multiple expression systems can be utilized for recombinant production of Drosophila melanogaster proteins, including KRTCAP2 homolog, each with specific advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid productionMay lack post-translational modifications
YeastEukaryotic processing, higher-order foldingModerate yield, longer production time
BaculovirusInsect-derived modifications, closer to native stateComplex setup, higher cost
Mammalian cellMost complete post-translational modificationsLowest yield, highest cost

For membrane-associated proteins like KRTCAP2 homolog, insect cell expression systems often provide the best balance of yield and proper folding characteristics . When selecting an expression system, consider your downstream applications and whether post-translational modifications are essential for functional studies.

How can researchers confirm the identity and purity of recombinant KRTCAP2 homolog?

Confirmation of identity and purity requires multiple analytical approaches. Begin with SDS-PAGE to verify molecular weight, followed by Western blotting using antibodies specific to KRTCAP2 homolog or tag epitopes. Mass spectrometry provides definitive protein identification through peptide mass fingerprinting. For purity assessment, size-exclusion chromatography combined with dynamic light scattering can detect aggregation states. Additional validation can include N-terminal sequencing and analytical ultracentrifugation for higher resolution analyses. Documentation should include all characterization data to ensure reproducibility in downstream experimental applications.

What functional domains of KRTCAP2 homolog are critical for protein-protein interactions in Drosophila signaling pathways?

Based on structural analyses and homology modeling, KRTCAP2 homolog likely contains transmembrane domains that facilitate membrane anchoring and protein-protein interactions. While specific interaction domains remain under investigation, comparison with related proteins suggests potential interaction sites. Similar to studies with Drosophila Trp proteins, which demonstrated specific domains involved in receptor-stimulated calcium entry, KRTCAP2 homolog may contain analogous functional regions . Site-directed mutagenesis approaches targeting conserved residues, followed by co-immunoprecipitation assays, can help identify critical interaction domains. Yeast two-hybrid screening and proximity labeling techniques provide complementary approaches for mapping the interactome of KRTCAP2 homolog in Drosophila signaling networks.

How do post-translational modifications affect KRTCAP2 homolog function?

Post-translational modifications (PTMs) likely play crucial roles in regulating KRTCAP2 homolog function. Similar to other membrane proteins in Drosophila, potential modifications include phosphorylation, glycosylation, and lipidation. When investigating PTMs:

  • Utilize mass spectrometry approaches (MS/MS or LC-MS/MS) to identify modification sites

  • Perform site-directed mutagenesis of putative modification sites to assess functional impact

  • Compare PTM patterns between recombinant protein and native protein from Drosophila tissues

  • Assess differences in PTMs across developmental stages and tissue types

Expression in different systems (E. coli vs. eukaryotic) will yield proteins with varying modification patterns, potentially affecting functional studies . Researchers should consider using phosphatase inhibitors during protein isolation if studying phosphorylation states, and lectin affinity chromatography to enrich for glycosylated forms when relevant to the research question.

What approaches can be used to study the role of KRTCAP2 homolog in Drosophila immune response?

Investigation of KRTCAP2 homolog in immune response pathways requires integration of genetic, molecular, and cellular approaches. Whole-genome studies using RNA-seq or microarray analysis can reveal expression changes during immune challenge, similar to approaches used for other Drosophila proteins . CRISPR/Cas9-mediated gene editing allows creation of knockout or knockdown models to assess functional consequences in vivo. When designing immune challenge experiments:

ApproachApplicationOutcome Measures
Oral infection modelsNatural route of infectionSurvival rate, pathogen burden, gene expression
RNAi knockdownTissue-specific silencingPathway activation, antimicrobial peptide production
Recombinant protein injectionDirect functional testingPathogen clearance, hemocyte activity
Ex vivo hemocyte assaysCellular function testingPhagocytosis rates, ROS production

Comparison with known immune response genes and pathway components (Toll, Imd) will provide context for interpreting results and determining whether KRTCAP2 homolog functions in recognition, signaling, or effector phases of immunity .

What purification strategy yields the highest activity for recombinant KRTCAP2 homolog?

A multi-step purification strategy typically yields optimal results for recombinant membrane-associated proteins like KRTCAP2 homolog. Begin with affinity chromatography using tags such as His, GST, or Avi-tag, which facilitates initial capture with high specificity . Follow with ion exchange chromatography to remove contaminants with different charge properties. Size exclusion chromatography as a polishing step separates aggregates and degradation products. When working with membrane proteins:

  • Include appropriate detergents during lysis and purification (e.g., n-dodecyl-β-D-maltoside or CHAPS)

  • Consider using nanodiscs or liposomes for stabilization post-purification

  • Maintain glycerol (10-15%) in buffers to prevent aggregation

  • Include reducing agents if the protein contains cysteines

Activity assessment should be performed at each purification stage using functional assays relevant to the protein's known or predicted activities. Document yield, purity, and specific activity to establish optimal conditions for future preparations.

How can researchers optimize heterologous expression conditions for maximum yield of correctly folded KRTCAP2 homolog?

Optimization of expression conditions requires systematic evaluation of multiple parameters. For E. coli expression systems, consider testing:

ParameterVariables to TestMeasurement Methods
Temperature16°C, 25°C, 30°C, 37°CSDS-PAGE, Western blot, activity assay
Induction time2h, 4h, 6h, overnightYield quantification, solubility analysis
Inducer concentration0.1-1.0 mM IPTGExpression level vs. solubility balance
Media compositionLB, TB, 2XYT, auto-inductionBiomass and protein yield comparison
Codon optimizationRare codon analysisExpression level improvement

For baculovirus or mammalian expression systems, consider MOI (multiplicity of infection), cell density at infection, and harvest timing . Co-expression with chaperones may improve folding of complex proteins. Use fusion partners (SUMO, MBP, thioredoxin) to enhance solubility if expression yields primarily insoluble protein. Analyze protein quality using circular dichroism to confirm secondary structure elements and thermal shift assays to assess stability.

What are effective approaches for generating antibodies against Drosophila KRTCAP2 homolog?

Generation of specific antibodies requires careful consideration of antigen design and production strategy. Options include:

  • Full-length protein immunization: Provides antibodies against multiple epitopes but may encounter specificity issues

  • Peptide-based approach: Targets unique, surface-exposed sequences (typically 15-20 amino acids)

  • Recombinant domain immunization: Focuses on functional domains while avoiding transmembrane regions

When designing a peptide-based approach, analyze the protein sequence for regions of high antigenicity, surface accessibility, and minimal sequence conservation with related proteins. Conjugate peptides to carrier proteins (KLH or BSA) to enhance immunogenicity. For polyclonal antibody production, immunize rabbits using a prime-boost strategy with complete Freund's adjuvant followed by incomplete adjuvant. For monoclonal antibodies, mouse hybridoma technology or phage display libraries provide alternatives with higher specificity. Validate antibody specificity using Western blotting against recombinant protein and Drosophila tissue lysates, including appropriate knockout/knockdown controls.

What controls should be included when studying protein-protein interactions involving KRTCAP2 homolog?

Rigorous controls are essential for protein interaction studies to distinguish specific from non-specific interactions. Essential controls include:

  • Tag-only controls: Express and purify tag alone to identify tag-mediated interactions

  • Unrelated protein controls: Use similarly sized non-relevant proteins to establish baseline non-specific binding

  • Reciprocal co-immunoprecipitation: Confirm interactions by pulling down from both directions

  • Competitive binding assays: Demonstrate specificity through displacement with unlabeled protein

  • Negative controls using mutated binding domains: Confirm interaction site specificity

When performing co-immunoprecipitation experiments, optimize buffer conditions (salt concentration, detergent type and concentration) to maintain specific interactions while reducing background. For in vivo validation, consider proximity ligation assays or fluorescence resonance energy transfer (FRET) to confirm interactions in cellular contexts. Document all experimental conditions, including washing stringency and antibody concentrations, to ensure reproducibility.

How should researchers address discrepancies between in vitro and in vivo findings related to KRTCAP2 homolog function?

Discrepancies between in vitro and in vivo findings are common in protein function studies and require systematic investigation. Similar to observations in Drosophila Trp protein research, where functional differences were observed between expression systems, reconciling these discrepancies involves:

  • Examining differences in post-translational modifications between recombinant and native proteins

  • Assessing protein complex formation that may be absent in simplified in vitro systems

  • Investigating tissue-specific interaction partners that modulate function in vivo

  • Comparing concentration ranges between artificial overexpression and physiological levels

When confronting contradictory results, design experiments that bridge the gap between systems, such as ex vivo assays using isolated tissues or organotypic cultures . Consider genetic approaches (CRISPR/Cas9, RNAi) combined with biochemical validation to establish causality in functional studies. Document all experimental conditions comprehensively, including cell types, developmental stages, and environmental factors that might influence outcomes.

What strategies can overcome solubility issues when working with recombinant KRTCAP2 homolog?

Membrane-associated proteins like KRTCAP2 homolog frequently present solubility challenges during recombinant expression and purification. Effective strategies include:

ApproachImplementationConsiderations
Fusion partnersMBP, SUMO, thioredoxin tagsMay affect function, requires tag removal
Detergent screeningSystematic testing of 8-12 detergentsDifferent detergents for extraction vs. purification
Buffer optimizationpH, salt, additives (glycerol, arginine)Stability vs. activity tradeoffs
Truncation constructsRemove hydrophobic regionsMay compromise functional domains
Nanodiscs/liposomesReconstitution into lipid environmentsComplex protocols but near-native environment

When working with membrane proteins, consider employing mild solubilization conditions using detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin that preserve protein-protein interactions . If aggregation occurs during concentration, include osmoprotectants like trehalose or sucrose. For functional studies, reconstitution into artificial membrane systems may be necessary to observe native activity profiles. Monitor protein stability using thermal shift assays to identify optimal buffer compositions that maximize both solubility and functional integrity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.