Recombinant Drosophila melanogaster Protein odr-4 homolog (CG10616)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
CG10616; Protein odr-4 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-492
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG10616
Target Protein Sequence
MRTVLLSKHDELYLEKCAQENQFSYGIIVGHQADLTKSVVVHLARNNEEDADLEDLSEVR LTISDINSQALASQWLSASKMCPGSFDVIGIFVSSVRSDVVNEQSAEFKNAKKLFSDIYD LLLKSNSSFGVYTTDIAQTDFVFLSYSLADKKVLCKNYSYGNGGTFTNMEFRFVDKPFEW IQLECSYDFDDVLPILDSSRRVNIEDQFQSMIVSVRKNLLASEVFLQNEVVEDTIDLQAY IKKKKTKVDKLQPTSTTGGTATASSNTTDSLPRLASEGIIGGTETIRASIVLPMKCQLSK PTDIKVREFSGTLHMSGIITSKVFCNPRNSIADVKRFLRDDVLRSLITRIQVYCDGLTDP YVTNEALYISEPPRRVFFSLPSEGPSASVGAVVQFSEYLFRGEAPTVVVAQAKQILDVDL DPETISVEAEGLPDDTHFNNCKMDADCIDDSGIMTSSMPKPELSRSLYMVGIAVALLVLL SSVALHFVLAER
Uniprot No.

Target Background

Function
This protein may play a role in the trafficking of a subset of G-protein coupled receptors.
Database Links

KEGG: dme:Dmel_CG10616

STRING: 7227.FBpp0301023

UniGene: Dm.11320

Protein Families
ODR-4 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the molecular structure and basic characteristics of the Recombinant Drosophila melanogaster Protein odr-4 homolog (CG10616)?

The odr-4 homolog (CG10616) is a transmembrane protein identified in Drosophila melanogaster with a UniProt accession number Q9VTX8. Its primary sequence consists of 492 amino acids with the specific sequence beginning with MRTVLLSKHDELYLEKCAQENQFS and ending with VALLVLLSSVALHFVLAER . The protein contains transmembrane domains and is primarily localized to the endoplasmic reticulum (ER) as demonstrated through immunocytochemistry studies using Flag-tagged versions of the protein co-localized with ER markers such as TRAPα . The full-length recombinant protein is typically produced with an N-terminal 10xHis-tag to facilitate purification and detection in experimental settings .

What is the functional role of odr-4 homolog in Drosophila melanogaster?

The odr-4 homolog in Drosophila melanogaster functions primarily in G-protein coupled receptor (GPCR) maturation and trafficking. Research has demonstrated that odr-4 forms a complex with ODR-8/Ufm1 Specific Protease 2 at the endoplasmic reticulum, and this complex is essential for promoting the proper maturation of GPCRs through a Ufm1-independent mechanism . Specifically, odr-4 interacts with GPCRs like ODR-10 during their biosynthesis to ensure correct folding, quality control, and subsequent trafficking to their final cellular destinations . This function is critical for sensory neurons, particularly those involved in olfactory perception, where proper receptor localization is essential for detecting environmental chemical cues and initiating appropriate signaling cascades.

What are the known binding partners and protein complexes involving odr-4?

Research has identified several key binding partners of odr-4, primarily through co-immunoprecipitation experiments in heterologous expression systems. The major confirmed interactions include:

  • ODR-8/Ufm1 Specific Protease 2 (UfSP2): ODR-4 forms a complex with ODR-8 at the endoplasmic reticulum, as demonstrated through co-immunoprecipitation experiments in HEK293 cells co-transfected with ODR-4-FLAG and HA-ODR-8 . This interaction was confirmed with both ODR-4a and ODR-4b variants.

  • ODR-10 (odorant receptor): ODR-4 directly interacts with this GPCR, shown through co-immunoprecipitation of ODR-10-GFP with ODR-4b-FLAG in HEK293 cells . This interaction is functionally significant for receptor maturation.

  • Human ODR4 interaction with UfSP2: The human homolog of ODR-4 also interacts with UfSP2, suggesting evolutionary conservation of this protein complex and its function .

The interaction network extends to other proteins in the ER quality control system, though these relationships have been less extensively characterized in the literature.

What are the optimal storage and handling conditions for Recombinant Drosophila melanogaster Protein odr-4 homolog to maintain its stability?

For optimal stability and activity, the Recombinant Drosophila melanogaster Protein odr-4 homolog should be stored at -20°C for regular use, and at -80°C for extended storage periods . When working with the protein, it's recommended to:

  • Avoid repeated freeze-thaw cycles which can lead to protein denaturation and activity loss.

  • Prepare working aliquots that can be stored at 4°C for up to one week to minimize freeze-thaw damage.

  • Ensure protein solutions are prepared in appropriate buffers (typically phosphate-buffered or Tris-based buffers with physiological salt concentrations).

  • Handle the protein on ice when preparing experimental samples to prevent degradation.

The shelf life of the liquid form is approximately 6 months when stored at -20°C/-80°C, while the lyophilized form maintains stability for approximately 12 months at these temperatures . Stability can be affected by buffer composition, so additives like glycerol (typically 10-20%) may be incorporated to enhance long-term stability.

What expression systems are most effective for producing functional Recombinant Drosophila melanogaster Protein odr-4 homolog?

The most well-documented expression system for producing functional Recombinant Drosophila melanogaster Protein odr-4 homolog is the in vitro E. coli expression system . This bacterial system offers high yield and relatively straightforward purification protocols, particularly when the protein is expressed with an N-terminal 10xHis-tag for affinity chromatography.

For in vivo studies in Drosophila, genome-wide resources have been developed using fosmid libraries with GFP-tagged clones, which include regulatory elements for proper expression levels . This approach involves:

  • High-throughput recombineering in E. coli

  • Insertion of the tagging cassette through homologous recombination

  • Generation of transgenic flies

  • Validation of protein functionality through genetic complementation tests

These transgenic approaches are estimated to produce functional tagged proteins in approximately two-thirds of cases, making them valuable for studying protein expression and localization in developmental contexts.

What immunoprecipitation protocols are effective for studying odr-4 protein interactions?

Based on published research, effective immunoprecipitation protocols for studying odr-4 protein interactions typically follow this general methodology:

Table 1: Key Components of Successful odr-4 Immunoprecipitation Protocols

ComponentRecommended ApproachRationale
Cell SystemHEK293 cellsEfficiently express transmembrane proteins with correct folding
Protein TagsFLAG-tag for odr-4, HA-tag for binding partnersAllow specific antibody recognition
Cell LysisMild detergent buffer (e.g., 1% NP-40 or Triton X-100)Preserves protein complexes while solubilizing membrane proteins
ImmunoprecipitationAnti-FLAG or anti-HA antibodies conjugated to agarose/magnetic beadsHigh specificity for tagged proteins
DetectionWestern blot with anti-FLAG and anti-HA antibodiesConfirms co-precipitation of interacting proteins

The specific protocol used in successful studies includes:

  • Co-transfection of HEK293 cells with ODR-4-FLAG and HA-ODR-8 (or other potential interaction partners)

  • Cell harvesting and lysis after appropriate expression period (typically 48-72 hours)

  • Immunoprecipitation using the relevant antibodies (anti-FLAG or anti-HA)

  • Analysis of the resulting precipitates by immunoblot using the appropriate detection antibodies

This approach has successfully demonstrated interactions between ODR-4 and ODR-8, as well as between ODR-4 and ODR-10, establishing the existence of a functional complex at the ER involved in GPCR maturation.

How does odr-4 promote GPCR maturation through a Ufm1-independent mechanism, and what are the molecular details of this process?

The odr-4 protein promotes GPCR maturation through a specialized mechanism that is independent of the ubiquitin-fold modifier 1 (Ufm1) pathway, despite forming a complex with the Ufm1-specific protease 2 (UfSP2/ODR-8). This presents an intriguing mechanistic paradox that has been partially elucidated through biochemical and cellular studies .

The current model suggests that:

  • ODR-4 and ODR-8 form a stable complex at the endoplasmic reticulum membrane, with ODR-4 serving as an ER-resident transmembrane scaffold protein.

  • This complex directly interacts with nascent GPCRs like ODR-10 during their biosynthesis at the ER, as demonstrated through co-immunoprecipitation experiments .

  • Rather than utilizing the enzymatic deufmylation activity of UfSP2, the complex appears to function as a specialized chaperone system that facilitates proper GPCR folding and quality control.

  • The transmembrane domains of ODR-4 likely interact with the transmembrane regions of GPCRs, stabilizing them in conformations amenable to proper folding and maturation.

  • Without functional ODR-4, odorant receptors like ODR-10 are retained in the ER and fail to reach their cellular destinations, suggesting a role in overcoming ER quality control checkpoints.

The molecular details suggest that while ODR-8/UfSP2 retains its protease fold, its function in this complex differs from its canonical role in the Ufm1 pathway. This represents an evolutionary repurposing of an enzyme structure for a specialized cellular function in sensory neurons, particularly for the maturation of odorant receptors.

What techniques can be used to visualize the subcellular localization and trafficking of odr-4 in live Drosophila tissues?

Several advanced techniques can be employed to visualize the subcellular localization and trafficking of odr-4 in live Drosophila tissues:

  • GFP-Tagged Fosmid Transgenes: The genome-wide resource of GFP-tagged fosmid clones provides an excellent approach for visualizing odr-4 at endogenous expression levels . These constructs include regulatory elements that maintain normal expression patterns, allowing visualization in various developmental contexts including embryos, pupae, and adult flies.

  • GAL4-UAS System for Tissue-Specific Expression: For targeted studies in specific tissues, the GAL4-UAS system enables expression of fluorescently-tagged odr-4 in defined cell populations . This system allows for temporal and spatial control of expression, facilitating studies in specific neuronal subsets.

  • Live Imaging of Developing Tissues: Confocal microscopy of living embryos, larvae, or pupae expressing fluorescently-tagged odr-4 enables dynamic tracking of protein localization during development . This approach is particularly valuable for understanding protein redistribution during cellular differentiation or in response to stimuli.

  • FRAP (Fluorescence Recovery After Photobleaching): This technique can determine the mobility and turnover of odr-4 at the ER membrane by selectively photobleaching a region and measuring fluorescence recovery over time.

  • Correlative Light and Electron Microscopy (CLEM): Combining fluorescence microscopy with electron microscopy provides both dynamic visualization of tagged proteins and ultrastructural context.

These approaches have collectively demonstrated that odr-4 primarily localizes to the endoplasmic reticulum in various cell types, with particular enrichment in sensory neurons where GPCR trafficking is critical for function.

What is known about the evolutionary conservation of odr-4 function across species from C. elegans to humans?

The evolutionary conservation of odr-4 function spans from invertebrates to humans, with significant structural and functional similarities maintained across diverse species:

What are the most effective approaches for validating antibody specificity when studying odr-4 in Drosophila tissues?

Validating antibody specificity is crucial when studying odr-4 in Drosophila tissues to ensure accurate interpretation of experimental results. The following comprehensive approaches are recommended:

  • Genetic Validation: The most rigorous approach involves comparing antibody staining between wild-type tissues and tissues from odr-4 null mutants or knockdowns. Specific staining should be absent or significantly reduced in mutant tissues. This approach can be implemented using CRISPR-Cas9 based genome editing to generate odr-4 knockout lines .

  • Tagged Protein Co-localization: Generate transgenic flies expressing epitope-tagged versions of odr-4 (e.g., FLAG or GFP) and perform co-staining with the anti-odr-4 antibody and an antibody against the epitope tag. High correlation between signals provides evidence for specificity . The genome-wide fosmid library of GFP-tagged clones is particularly useful for this approach.

  • Western Blot Validation: Perform western blot analysis comparing wild-type and odr-4 mutant lysates. A specific antibody should detect a band of the appropriate molecular weight in wild-type samples that is absent in mutant samples.

  • Preabsorption Controls: Preincubate the antibody with excess purified recombinant odr-4 protein before staining tissues. This should eliminate specific staining if the antibody is truly recognizing odr-4.

  • Multiple Antibody Verification: Use multiple antibodies raised against different epitopes of odr-4. Consistent localization patterns across different antibodies increases confidence in specificity.

For immunocytochemistry studies, appropriate controls include semi-permeabilized versus intact cell comparisons to distinguish between cytoplasmic and extracellular epitopes, as has been done with odr-4 and odr-8 in HeLa cells .

What are the key considerations for designing functional studies to investigate the role of odr-4 in GPCR trafficking?

When designing functional studies to investigate odr-4's role in GPCR trafficking, researchers should consider several critical factors:

  • Genetic Manipulation Strategies:

    • CRISPR-Cas9 genome editing for generating precise knockouts or tagged versions at endogenous loci

    • GAL4-UAS system for tissue-specific expression or knockdown

    • Temperature-sensitive alleles for temporal control of protein function

  • Model GPCRs for Trafficking Studies:

    • ODR-10 is a well-established model GPCR that interacts with odr-4

    • Using fluorescently-tagged GPCRs allows visualization of trafficking defects

    • Include multiple GPCR types to determine specificity or generality of odr-4 function

  • Cellular Readouts for Trafficking Defects:

    • Subcellular localization analysis (ER retention versus proper membrane targeting)

    • Surface expression quantification using surface biotinylation or flow cytometry

    • Functional assays for receptor activity (e.g., calcium imaging, cAMP measurement)

  • Interaction Analysis:

    • Co-immunoprecipitation to identify novel components of the trafficking machinery

    • Proximity labeling approaches (BioID, APEX) to identify transient interactions

    • Structure-function analysis with domain mutants to map interaction interfaces

  • In vivo Functional Assays:

    • Behavioral tests for sensory function (e.g., olfactory jump-test assay)

    • Electrophysiological recordings from sensory neurons

    • Analysis of developmental phenotypes associated with sensory deficits

A comprehensive experimental design would combine genetic manipulation of odr-4 with visualization of model GPCR trafficking and functional outcome measures. For instance, tissue-specific knockdown of odr-4 coupled with imaging of fluorescent odorant receptors and olfactory behavioral assays provides a multi-level analysis of protein function in a physiologically relevant context.

What analytical methods and statistical approaches are appropriate for quantifying changes in protein localization and interaction studies involving odr-4?

Quantifying changes in protein localization and interactions involving odr-4 requires rigorous analytical methods and appropriate statistical approaches:

For Localization Studies:

  • Colocalization Analysis:

    • Pearson's correlation coefficient or Manders' overlap coefficient to quantify spatial correlation between odr-4 and cellular markers

    • Object-based colocalization for punctate structures

    • Minimum sample size of 10-15 cells per condition across 3 independent experiments

  • Intensity Distribution Analysis:

    • Line scan analysis across cellular regions to quantify spatial distribution

    • Intensity ratio measurements between compartments (e.g., ER vs. Golgi vs. plasma membrane)

    • Statistical comparison using ANOVA with appropriate post-hoc tests for multiple comparisons

  • Dynamic Analysis in Live Imaging:

    • Tracking particle movement using specialized software (e.g., TrackMate in ImageJ)

    • Measuring fluorescence recovery parameters in FRAP experiments (mobile fraction, half-time of recovery)

    • Analysis of variance components for time-series data

For Protein Interaction Studies:

  • Co-Immunoprecipitation Quantification:

    • Densitometry of western blot bands normalized to input and immunoprecipitated bait protein

    • At least three biological replicates for statistical comparison

    • Paired t-tests or repeated measures ANOVA for comparing conditions

  • Proximity Ligation Assay (PLA) Analysis:

    • Counting PLA puncta per cell using automated image analysis

    • Comparing distributions using appropriate non-parametric tests if data does not meet normality assumptions

  • FRET/BRET Analysis for Protein Interactions:

    • Calculating FRET efficiency with appropriate controls for spectral bleed-through

    • Statistical comparison of FRET efficiencies across experimental conditions

Standardized Reporting Recommendations:

  • Always report sample sizes, statistical tests used, and exact p-values

  • Include both biological and technical replicates in experimental design

  • Use appropriate controls for each experiment (positive, negative, and experimental controls)

  • Consider power analysis to determine adequate sample sizes

  • Address potential confounding variables such as expression levels of tagged proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.