Recombinant Drosophila melanogaster Protein rhomboid (rho)

Shipped with Ice Packs
In Stock

Description

Biological Functions

Recombinant Rhomboid (rho) is functionally active in vitro and in vivo, enabling researchers to dissect its roles:

  • EGFR Ligand Activation: Cleaves Spitz, releasing its extracellular domain to activate EGFR signaling in neighboring cells .

  • Developmental Regulation: Controls dorsoventral patterning in embryos via maternal signaling and neuroectoderm differentiation .

  • Tissue Homeostasis: Maintains intestinal stem cell equilibrium by regulating feedback loops in EGFR signaling .

  • Disease Relevance: Linked to parasitic infections (e.g., Toxoplasma and Plasmodium) through conserved proteolytic mechanisms .

Key Research Findings

Table 2: Experimental Insights Using Recombinant Rhomboid (rho)

Study FocusMethodologyKey OutcomeReference
Protease MechanismIn vitro cleavage assaysDemonstrated intramembrane cleavage of Spitz within its transmembrane domain.
Evolutionary ConservationHeterologous expression in bacteriaGram-negative and Gram-positive Rhomboids cleave Drosophila Spitz, confirming ancient origin.
Cardiac DevelopmentTransgenic rescue in rho3 mutantsRestored adult heart function by reactivating EGFR signaling pathways.
miRNA RegulationSingle-molecule FISH and IFmiR-9a post-transcriptionally regulates rho mRNA stability and translation.

Regulatory Mechanisms

Recombinant Rhomboid (rho) activity is tightly controlled by:

  • Transcriptional Regulation: Expression prefigures EGFR signaling events during development .

  • Post-Translational Control: miR-9a suppresses rho mRNA levels and delays protein accumulation in early embryos .

  • Competitive Inhibition: Sna repressor blocks ventral expression by binding promoter sites adjacent to activator motifs .

Applications in Research

  • Drug Discovery: Serves as a model for designing rhomboid protease inhibitors to target parasitic infections .

  • Signal Transduction Studies: Reconstitutes EGFR activation pathways in heterologous systems .

  • Genetic Rescue: Reverses phenotypic defects in roughoid mutants (e.g., cardiac dilation) via transgenic expression .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you require a specific tag, please communicate your preference. We will prioritize developing the specified tag if possible.
Synonyms
rho; Ve; CG1004; Protein rhomboid; Protein veinlet
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
rho
Target Protein Sequence
MENLTQNVNETKVDLGQEKEKEASQEEEHATAAKETIIDIPAACSSSSNSSSYDTDCSTA SSTCCTRQGEHIYMQREAIPATPLPESEDIGLLKYVHRQHWPWFILVISIIEIAIFAYDR YTMPAQNFGLPVPIPSDSVLVYRPDRRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPL EVMHGTARIGVIYMAGVFAGSLGTSVVDSEVFLVGASGGVYALLAAHLANITLNYAHMKS ASTQLGSVVIFVSCDLGYALYTQYFDGSAFAKGPQVSYIAHLTGALAGLTIGFLVLKNFG HREYEQLIWWLALGVYCAFTVFAIVFNLINTVTAQLMEEQGEVITQHLLHDLGVS
Uniprot No.

Target Background

Function
Rhomboid plays a crucial role in early embryonic development, establishing positional information along the dorsoventral axis and later specifying the fate of neuronal precursor cells. It is involved in EGF receptor signaling, cleaving Spitz to release the active growth factor.
Gene References Into Functions
  1. A rhomboid enhancer element selectively labeling four Drosophila embryonic neural precursors was characterized. PMID: 26252385
  2. The structure and mechanism of the rhomboid protease were investigated. PMID: 23585569
  3. An analysis of EGFR-dependent network interactions involved in patterning Drosophila eggshell appendages was conducted. Each appendage originates from a primordium composed of a patch of cells expressing broad (br) and an adjacent stripe of cells expressing rhomboid (rho). PMID: 22782725
  4. Drosophila RHO, the founding member of a previously uncharacterized serine protease family, could be directly responsible for the unusual, intramembranous cleavage of EGFr ligands. PMID: 12221285
  5. Mgm1p, a key component of mitochondrial fusion, is activated by a novel mitochondrial endopeptidase related to this Drosophila melanogaster signaling protein. PMID: 12776123
  6. Substrate specificity of RHO intramembrane protease is determined by helix-breaking residues in the transmembrane domain. PMID: 12820957
  7. The evolution of the trans-regulatory environment controlling rho expression in somatic follicle cells might significantly contribute to the evolutionary changes in DA number. PMID: 17360774
  8. Rhomboid may function in R8 cells to activate Epidermal growth factor receptor signaling in R7 cells PMID: 19261861

Show More

Hide All

Database Links

KEGG: dme:Dmel_CG1004

STRING: 7227.FBpp0305409

UniGene: Dm.808

Protein Families
Peptidase S54 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the basic function of rhomboid proteases in Drosophila melanogaster?

Rhomboid proteases in Drosophila melanogaster function primarily as intramembrane serine proteases that cleave membrane-anchored signaling molecules, particularly EGFR ligands like Spitz. Rhomboid-1, the most extensively characterized family member, cleaves these ligands within their transmembrane domains, facilitating their release from the membrane and enabling them to activate EGFR signaling in neighboring cells . This proteolytic activity represents one of the first discovered examples of regulated intramembrane proteolysis for growth factor activation. The process is critical for numerous developmental processes, including dorsal-ventral axis formation, where spatially restricted rhomboid expression leads to selective EGFR activation in follicular cells . Additionally, rhomboid proteases participate in protein quality control pathways that maintain proteome health, contributing to cellular protein homeostasis .

How many rhomboid family members exist in Drosophila, and what are their distinct functions?

Drosophila possesses multiple rhomboid-like genes with specialized functions. The main characterized members include:

  • Rhomboid-1: The primary regulator of EGFR signaling, involved in multiple developmental processes .

  • Roughoid/Rhomboid-3: Cooperates with Rhomboid-1 in controlling cell recruitment during eye development and has been linked to cardiac function .

  • Additional rhomboid-like genes: Several other members have been identified through genome sequencing but remain less characterized .

These proteases exhibit tissue-specific expression patterns and can have both overlapping and distinct functions. For instance, while Rhomboid-1 plays broad developmental roles, partial inhibition of Rhomboid-3 specifically causes enlargement of the cardiac chamber in adult Drosophila through EGFR pathway inhibition . This functional diversity makes understanding the specific activity of each family member essential for comprehensive experimental design.

What is the structural basis for rhomboid protease activity?

Rhomboid proteases function through a conserved serine-histidine catalytic dyad located within the membrane bilayer, which enables them to cleave substrate transmembrane domains . This intramembrane proteolytic mechanism represents a specialized adaptation for processing membrane-anchored signaling molecules. The active site architecture allows rhomboids to recognize specific sequences within the transmembrane domains of their substrates, providing selectivity in their action. X-ray crystallography and mutational analyses have revealed that the catalytic serine residue typically resides within a transmembrane segment, positioned to attack the scissile peptide bond of the substrate within the lipid bilayer. This unusual active site positioning explains why rhomboid substrates are cleaved within their transmembrane domains, releasing their extracellular portions for signaling activities .

What are the optimal methods for expressing recombinant Drosophila rhomboid proteins?

The expression of recombinant Drosophila rhomboid proteins presents several technical challenges due to their polytopic membrane protein nature. For successful expression, researchers should consider:

  • Expression systems: Both prokaryotic (E. coli) and eukaryotic (insect cells, particularly Sf9 or S2 cells) systems have been used successfully. For functional studies, eukaryotic systems are preferred as they provide appropriate membrane environments and post-translational modifications.

  • Affinity tags: N-terminal or C-terminal tags (His6, FLAG, or GST) facilitate purification but should be tested to ensure they don't interfere with activity. Cleavable tags are recommended for functional studies.

  • Membrane solubilization: Gentle detergents like DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) help maintain protein structure and activity during purification.

  • Expression temperature: Lower temperatures (16-25°C) often improve proper folding and reduce aggregation.

When designing expression constructs, it's crucial to preserve the catalytic residues (serine-histidine dyad) and transmembrane topology for functional studies . For heterologous expression, codon optimization for the host organism may improve yields.

How can researchers effectively measure rhomboid protease activity in vitro?

Several complementary approaches can be employed to measure rhomboid protease activity:

  • Fluorogenic peptide substrates: Custom-designed peptides containing a fluorophore and quencher that span the rhomboid recognition and cleavage site. Cleavage separates the fluorophore from the quencher, resulting in increased fluorescence.

  • Immunoblotting assays: Using known substrates like Spitz, where cleavage produces fragments of predictable sizes that can be detected by Western blotting . This approach allows quantification of both substrate and product.

  • Mass spectrometry: For precise identification of cleavage sites and kinetics analysis. This technique can reveal the exact peptide bond being hydrolyzed within the transmembrane domain.

  • In-cell assays: Co-expression of the rhomboid protease with a tagged substrate in cultured cells, followed by detection of secreted cleaved products in the medium by immunoblotting or ELISA.

  • Liposome reconstitution systems: Purified rhomboid proteins reconstituted into liposomes with defined lipid composition, allowing for controlled studies of how membrane environment affects activity.

For all these methods, appropriate controls are essential, including catalytically inactive mutants (typically with the active site serine mutated to alanine) and known inhibitors like 3,4-dichloroisocoumarin or isocoumarin-based compounds .

What are the most reliable genetic approaches for studying rhomboid function in Drosophila?

Genetic approaches remain fundamental for elucidating rhomboid function in vivo:

  • Loss-of-function analysis:

    • Null mutations and deficiencies: Genomic deficiencies spanning the rhomboid loci have been valuable for assessing phenotypes. For example, deficiencies in the rhomboid-3 locus (d07829-f07223) demonstrate enlarged cardiac chambers in heterozygotes .

    • CRISPR/Cas9-mediated knockout: Allows precise targeting of specific rhomboid genes, avoiding off-target effects that might occur with RNAi approaches.

    • Temperature-sensitive dominant-negative constructs: Particularly useful for temporal control of rhomboid inhibition, as demonstrated with EGFR pathway components .

  • Gain-of-function approaches:

    • GAL4-UAS system: Enables tissue-specific overexpression of wild-type or mutant rhomboid proteins.

    • Rescue experiments: Expression of wild-type rhomboid in mutant backgrounds provides strong evidence for gene function, as shown by the rescue of cardiac function through cardiac-specific expression of rhomboid-3 in deficiency backgrounds .

  • Mosaic analysis:

    • Clonal analysis using FLP/FRT: Allows assessment of cell-autonomous versus non-cell-autonomous effects of rhomboid, particularly important for signaling studies .

  • Pathway analysis:

    • Genetic interaction studies: Testing double mutants or combinations of pathway components helps position rhomboid within signaling networks.

    • Suppressor/enhancer screens: Useful for identifying new rhomboid interactors or regulators.

These approaches have revealed key insights, such as the demonstration that Rhomboid-1 and Roughoid/Rhomboid-3 function specifically in signal-emitting cells rather than signal-receiving cells during eye development .

How does rhomboid contribute to dorsal-ventral axis formation in Drosophila?

Rhomboid plays a crucial role in establishing dorsal-ventral asymmetry during Drosophila oogenesis and embryogenesis through the following mechanisms:

  • Spatially restricted expression: Rhomboid protein is localized to the apical surface of dorsal-anterior follicle cells surrounding the oocyte, creating the initial asymmetry required for axis formation .

  • EGFR pathway activation: The spatially restricted rhomboid selectively activates the EGFR in dorsal follicle cells by processing the EGFR ligand (likely Gurken), leading to specification of dorsal follicle cell fates .

  • Feedback regulation: EGFR signaling initiated by rhomboid activity establishes positive and negative feedback mechanisms that refine signaling patterns, ultimately defining precise cell fates within the follicular epithelium .

  • Phenotypic consequences: Loss of rhomboid function causes ventralization of both the eggshell and embryo, while ectopic expression leads to dorsalization of these structures, demonstrating that spatially restricted rhomboid is both necessary and sufficient for dorsal-ventral axis formation .

This process represents one of the earliest examples of asymmetric tissue patterning, where a spatially localized protease activity triggers a signaling cascade that establishes the body plan. The initial asymmetry established during oogenesis is maintained and elaborated during embryogenesis, highlighting the critical developmental timing of rhomboid function .

What is the relationship between rhomboid and EGFR signaling in Drosophila development?

The relationship between rhomboid and EGFR signaling represents a paradigm for proteolytic regulation of growth factor signaling:

  • Proteolytic activation: Rhomboid-1 directly cleaves membrane-tethered EGFR ligands (particularly Spitz) within their transmembrane domains, releasing active ligands that can diffuse and bind to EGFR on neighboring cells .

  • Regulated substrate trafficking: The transport factor Star guides Spitz from the endoplasmic reticulum to the Golgi, where it encounters Rhomboid-1, demonstrating that spatial control of both the protease and substrate contributes to signaling specificity .

  • Tissue-specific cooperation: Different rhomboid family members cooperate in specific developmental contexts. For example, Rhomboid-1 and Roughoid/Rhomboid-3 work together to control cell recruitment in eye development by triggering EGFR activation .

  • Cardiac development: Partial inhibition of Rhomboid-3 causes cardiac chamber enlargement through inhibition of EGFR signaling. This phenotype can be rescued by expressing activated Spitz or EGFR, demonstrating the linear relationship between rhomboid activity, Spitz processing, and EGFR activation .

  • Multiple developmental processes: Beyond dorsal-ventral patterning and eye development, rhomboid-dependent EGFR signaling regulates numerous developmental events, including wing vein formation, muscle development, and nervous system patterning .

How do rhomboid-1 and rhomboid-3 cooperate in Drosophila eye development?

The cooperative function of Rhomboid-1 and Rhomboid-3 (Roughoid) in Drosophila eye development represents an elegant example of coordinated protease activity in tissue patterning:

This cooperation demonstrates how multiple proteases with similar biochemical activities can have non-redundant developmental functions due to differences in expression patterns, regulation, or subtle differences in substrate preferences.

How do mammalian rhomboid proteases differ from Drosophila rhomboids?

While the catalytic mechanism of rhomboid proteases is highly conserved from bacteria to humans, mammalian rhomboids exhibit several important differences from their Drosophila counterparts:

  • Substrate diversity: Unlike Drosophila rhomboids that primarily process EGFR ligands, mammalian rhomboids appear to have different substrate specificities. For instance, RHBDL4 (Rhbdd1) promotes trafficking of diverse membrane proteins, including the EGFR ligand TGFα, from the ER to the Golgi . Other identified substrates of mammalian rhomboids include ephrin B and thrombomodulin, rather than EGF family ligands .

  • Subcellular localization: While Drosophila Rhomboid-1 primarily localizes to the Golgi apparatus, mammalian rhomboids show diverse subcellular distributions. RHBDL4, for example, localizes to the ER and regulates protein trafficking within the early secretory pathway .

  • Signaling context: Mammalian rhomboids do not appear to be the primary regulators of EGF signaling, contrasting with the central role of Drosophila rhomboids in this pathway. Instead, they participate in diverse cellular processes including protein quality control and membrane protein trafficking .

  • Regulation by GPCRs: Mammalian RHBDL4-dependent trafficking control is regulated by G-protein coupled receptors, suggesting integration with different signaling pathways than in Drosophila .

  • Expanded family diversity: Mammals possess an expanded repertoire of both rhomboid proteases and inactive rhomboid pseudoproteases that participate in protein homeostasis and other membrane-related processes .

Despite these differences, the fundamental proteolytic mechanism involving a serine-histidine catalytic dyad that cleaves within transmembrane domains remains conserved across evolution .

What is the role of rhomboid superfamily members in protein homeostasis?

The rhomboid superfamily has emerging roles in maintaining protein homeostasis through several mechanisms:

  • Quality control functions: Rhomboid family members participate in protein quality control pathways that maintain a healthy proteome. Dysfunction in these pathways can lead to diseases associated with proteinopathies .

  • ERAD pathway involvement: Some rhomboid pseudoproteases (particularly derlins) are integral components of the ER-associated degradation (ERAD) pathway, which recognizes and eliminates misfolded proteins from the ER .

  • Trafficking regulation: RHBDL4 promotes trafficking of specific membrane proteins from the ER to the Golgi apparatus, thereby facilitating their secretion via extracellular microvesicles. This function serves as a rheostat that tunes secretion dynamics and abundance of specific membrane protein cargoes .

  • Integration with cellular signaling: RHBDL4-dependent trafficking control is regulated by G-protein coupled receptors, suggesting that rhomboids reorganize trafficking events within the early secretory pathway in response to external signals .

  • Disease relevance: The role of rhomboid superfamily members in protein homeostasis suggests their potential involvement in diseases characterized by protein misfolding and aggregation. Understanding their systemic significance in mammals may reveal important therapeutic targets .

This expanding functional portfolio highlights how an ancient membrane-embedded proteolytic mechanism has been adapted through evolution to serve diverse roles in cellular protein management beyond growth factor regulation .

How can researchers analyze potential novel substrates for rhomboid proteases?

Identifying and validating novel rhomboid substrates requires a multi-faceted approach:

  • Bioinformatic prediction:

    • Sequence analysis for potential transmembrane domain cleavage sites based on known substrates

    • Structural modeling to assess accessibility of candidate regions within the membrane

    • Evolutionary conservation analysis of potential cleavage sites

  • In vitro substrate screening:

    • Recombinant expression of candidate substrate transmembrane domains

    • Direct proteolysis assays using purified rhomboid proteases

    • Mass spectrometry to identify precise cleavage sites

  • Cell-based validation approaches:

    • Co-expression of rhomboid proteases with tagged candidate substrates

    • Monitoring substrate cleavage and secretion via immunoblotting

    • Using rhomboid inhibitors to confirm specificity of observed cleavage

    • CRISPR/Cas9 knockout of rhomboid genes to assess effects on endogenous substrate processing

  • Comparative substrate profiling across species:

    • Testing whether substrates are conserved between Drosophila and mammalian rhomboids

    • Comparing substrate preferences of different rhomboid family members

  • Structural determinants of specificity:

    • Mutagenesis of potential recognition motifs within candidate substrates

    • Chimeric substrate analysis to identify transferable recognition elements

A comprehensive substrate identification strategy should combine these approaches, as exemplified by studies that have identified both expected substrates (like Spitz) and unexpected ones (like ephrin B and thrombomodulin) . The challenge often lies in distinguishing direct rhomboid substrates from proteins affected indirectly through changes in trafficking or other cellular processes.

How conserved are rhomboid proteases throughout evolution?

Rhomboid proteases represent one of the most widely conserved protease families, with members identified across all kingdoms of life:

This evolutionary pattern suggests that the rhomboid proteolytic mechanism emerged early in evolution as a solution to the challenge of regulated proteolysis within membranes, and has subsequently been adapted to diverse cellular processes across the tree of life .

What can comparative studies of rhomboid proteases tell us about their function?

Comparative studies across species provide valuable insights into rhomboid biology:

  • Conserved mechanisms: Studies showing that human Rhomboid can promote Spitz cleavage through a mechanism similar to Drosophila Rhomboid-1 reveal fundamental conservation of the proteolytic mechanism, despite different physiological roles .

  • Divergent functions: While Drosophila rhomboids primarily regulate EGFR signaling, mammalian rhomboids have diversified to regulate protein trafficking, quality control, and other signaling pathways. This functional divergence suggests that the ancient proteolytic mechanism has been repurposed multiple times during evolution .

  • Substrate recognition principles: Cross-species substrate testing helps identify conserved features required for rhomboid recognition, distinguishing fundamental recognition elements from species-specific adaptations.

  • Evolutionary conservation mapping: Comparative genomics reveals highly conserved residues likely essential for function, versus more variable regions that might confer species-specific functions or regulation.

  • Disease models: The ability to model human disease-associated rhomboid mutations in model organisms like Drosophila provides functional insights. For example, the cardiac phenotypes associated with rhomboid-3 mutation in Drosophila suggest potential roles for rhomboid proteases in human cardiac diseases .

The observation that rhomboid proteases have diverged functionally while maintaining their core proteolytic mechanism makes them excellent subjects for evolutionary studies of how ancient enzymes can be adapted to new biological contexts .

What are the major technical challenges in rhomboid protease research?

Researchers studying rhomboid proteases face several significant technical challenges:

  • Membrane protein expression and purification:

    • Low expression yields due to their polytopic membrane nature

    • Maintaining proper folding and activity during solubilization and purification

    • Ensuring appropriate lipid environments for functional studies

  • Assay limitations:

    • Difficulty in developing high-throughput assays for membrane-embedded proteolysis

    • Challenges in distinguishing direct from indirect effects in cellular contexts

    • Limited availability of validated antibodies for many rhomboid family members

  • Substrate identification:

    • Predicting cleavage sites within transmembrane domains remains imprecise

    • Distinguishing genuine substrates from proteins affected by indirect mechanisms

    • Validating physiological relevance of identified substrates in vivo

  • Structural studies:

    • Obtaining high-resolution structures of rhomboids with bound substrates

    • Capturing different conformational states during the catalytic cycle

    • Understanding how membrane composition affects activity

  • Redundancy and compensation:

    • Functional overlap between rhomboid family members complicates loss-of-function studies

    • Genetic compensation mechanisms may mask phenotypes in knockout models

These challenges necessitate combining diverse approaches, including biochemical, genetic, structural, and computational methods, to fully understand rhomboid biology .

What are promising therapeutic applications of rhomboid protease research?

While still largely in exploratory stages, rhomboid protease research suggests several promising therapeutic directions:

  • Cardiac disease applications: The discovery that rhomboid-3 mutations cause dilated heart phenotypes in Drosophila suggests potential roles in human cardiomyopathies. Understanding these pathways could lead to therapeutic targets for heart failure .

  • Protein misfolding disorders: Given their roles in protein homeostasis, targeting rhomboid superfamily members might offer approaches for treating diseases associated with protein misfolding and aggregation, including neurodegenerative disorders .

  • Cancer therapeutics: Since rhomboids regulate growth factor signaling in Drosophila, and mammalian rhomboids affect protein trafficking and secretion, they might represent targets for modulating aberrant signaling in cancer cells .

  • Infectious disease: Rhomboid proteases in parasites like Plasmodium and Toxoplasma are essential for host cell invasion, making them potential targets for anti-parasitic drugs.

  • Modulators of protein secretion: The ability of RHBDL4 to affect secretion of specific membrane proteins suggests potential for modulating pathological protein secretion in disease contexts .

The therapeutic potential of rhomboid modulation will depend on developing highly specific inhibitors or activators that can distinguish between closely related family members, as well as on a deeper understanding of their physiological functions in mammals .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.