Amino Acid Sequence: The full-length protein (1–275 residues) has the sequence:
MQLFDDFCKSFNKELQRANFGFAYNRVHLFYRSQWQKDEINTIYLLYRWIWALFFLGVYI...
Domain Architecture: Predicted transmembrane regions align with its role in membrane-associated processes .
| Property | Detail |
|---|---|
| Gene Name | rost (CG9552) |
| UniProt ID | O44252 |
| Expression Host | E. coli |
| Tag | N-terminal His-tag |
| Molecular Weight | ~31 kDa (calculated) |
| Purity | >90% (SDS-PAGE verified) |
rost is essential for somatic muscle formation in Drosophila embryos, specifically mediating myoblast fusion :
Mechanism: Facilitates cell–cell recognition and adhesion between muscle founder cells and fusion-competent myoblasts.
Phenotypic Impact:
Storage:
Recombinant rost is utilized in:
Mechanistic Studies: Elucidating fusion pathways via in vitro assays .
Protein Interaction Screens: Yeast two-hybrid or co-IP assays to identify binding partners .
Antibody Production: Immunogen for generating rost-specific antibodies .
Further studies could explore:
Structural resolution of rost’s transmembrane domains.
Cross-species homologs to assess evolutionary conservation.
High-throughput screens for rost-interacting small molecules.
KEGG: dme:Dmel_CG9552
UniGene: Dm.7302
Rolling stone (rost) is a Drosophila melanogaster protein that plays a critical role in myoblast fusion during embryonic development. When mutated, it specifically blocks the fusion of mononucleated cells to myotubes in the body wall musculature. The rost gene is expressed in the embryonic nervous system and cells of the somatic mesoderm, particularly in muscle founder cells. While other mesodermal derivatives such as the visceral mesoderm and dorsal vessel develop normally in rost mutants, the body wall musculature shows significant defects, with myoblasts remaining as single mononucleated cells that still express muscle myosin .
The experimental evidence clearly demonstrates that rost is part of a select group of genes (including Drac1, myoblast city, and blown fuse) that are necessary for the fusion process during myogenesis. Unlike some other muscle development genes, rost does not affect the specification of muscle precursor cells but rather enables the fusion competence of myoblasts .
The rost gene shows a distinct expression pattern primarily in the embryonic nervous system and the somatic mesoderm, with notable expression in muscle founder cells. To elucidate this expression pattern, researchers constructed a rost promoter-lacZ P-element transformation vector containing approximately 400 bp upstream of the putative rost ATG start codon. This construct was used to generate transgenic flies, and nine independent insertions were tested for reporter gene expression using anti-β-Gal antibodies .
The results confirmed that rost expression in the mesoderm is essential for myoblast fusion. Importantly, when antisense rost transcript was specifically expressed within the mesoderm of wild-type embryos, it resulted in fusion defects of myoblasts, providing direct experimental evidence that mesodermal expression of rost is responsible for the observed phenotype in rost mutants .
Recombinant rost protein can be produced using E. coli expression systems with appropriate fusion tags to facilitate purification. The full-length Drosophila melanogaster rost protein (amino acids 1-275) has been successfully expressed with an N-terminal His-tag in E. coli . The protein is typically obtained as a lyophilized powder after purification and can achieve greater than 90% purity as determined by SDS-PAGE analysis.
For researchers working with recombinant rost protein, the following protocol is recommended:
Expression in E. coli using standard induction protocols
Purification using His-tag affinity chromatography
Quality control via SDS-PAGE to confirm purity (>90%)
Lyophilization for storage stability
Reconstitution in deionized sterile water to 0.1-1.0 mg/mL
Addition of 5-50% glycerol (final concentration) for long-term storage
Aliquoting to avoid repeated freeze-thaw cycles
This approach yields functional protein suitable for biochemical and cellular assays investigating rost's role in myoblast fusion.
Several genetic approaches have proven effective for studying rost function in vivo:
P-element mutagenesis: The original rost mutant was generated using P-element mutagenesis with the pUCsneo vector, which can be excised from the P-strain and transformed into bacterial hosts. This approach identified a single P-element insertion at chromosomal region 29F/30A on the left arm of the second chromosome that was responsible for the rost phenotype .
P-element mobilization: To verify that the P-element was indeed causing the rost phenotype, researchers mobilized the P-element from the strain. Excision of the P-element reverted the lethal phenotype to viability, and staining with β3 tubulin antibody confirmed proper muscle development in these revertants .
Antisense expression: Researchers expressed antisense rost transcript specifically within the mesoderm of wild-type embryos, which resulted in fusion defects of myoblasts. This proved that mesodermal expression of rost is responsible for the observed phenotype .
Promoter analysis: A rost promoter-lacZ construct was generated to study the expression pattern of the gene. This approach helped identify the tissues where rost is expressed and provided insights into its regulation .
These genetic approaches have been instrumental in understanding the role of rost in myoblast fusion and can serve as a framework for investigating other aspects of its function.
For effective immunostaining of rost protein in Drosophila tissues, researchers should consider the following protocol based on successful approaches used in rost studies:
Fixation: Fix embryos or tissues in 4% paraformaldehyde in PBS for 20 minutes at room temperature.
Permeabilization: Wash in PBS with 0.1% Triton X-100 (PBT) to permeabilize cell membranes.
Blocking: Block in 5% normal goat serum in PBT for 1 hour at room temperature.
Primary antibody: Incubate with anti-rost antibody (diluted appropriately in blocking solution) overnight at 4°C. For co-localization studies, combine with other relevant antibodies such as anti-β3 tubulin or anti-MHC (Myosin Heavy Chain).
Washing: Wash 3-5 times in PBT.
Secondary antibody: Incubate with fluorescently-labeled secondary antibodies for 2 hours at room temperature.
Final washes: Wash 3-5 times in PBT.
Mounting: Mount in appropriate medium with anti-fade agent.
This protocol has been effective for visualizing protein expression patterns in Drosophila embryos and can be adapted specifically for rost detection. When combined with markers for muscle founder cells or fusion-competent myoblasts, this approach can provide valuable insights into the spatiotemporal dynamics of rost function during myoblast fusion .
The rost protein functions within a complex network of proteins that mediate myoblast fusion in Drosophila. Research has identified several other genes involved in this process, including Drac1, myoblast city (mbc), and blown fuse (blow). The precise interactions between rost and these proteins remain an active area of investigation .
Current evidence suggests that rost functions in a similar pathway as mbc, as mutations in both genes result in similar phenotypes where muscle precursors are specified but myoblasts are not competent for fusion. In both rost and mbc mutants, a high number of unfused myoblasts are observable, but the early muscle precursor cells are properly formed .
Molecular interaction studies using techniques such as co-immunoprecipitation, yeast two-hybrid screens, or proximity labeling approaches would be valuable to identify direct protein-protein interactions involving rost. Additionally, genetic interaction studies, where combinations of mutations in rost and other fusion-related genes are analyzed, could provide insights into the hierarchy and relationships within this pathway.
The transmembrane nature of rost suggests it may function in cell recognition, adhesion, or in mediating membrane fusion events. Further research is needed to determine whether rost interacts directly with other fusion machinery components or serves as a scaffold for organizing other fusion proteins at the cell membrane .
Rost expression shows tissue specificity, being predominantly expressed in the embryonic nervous system and cells of the somatic mesoderm, particularly in muscle founder cells. This expression pattern correlates with the observed phenotype in rost mutants, where fusion defects are restricted to the body wall musculature while other mesodermal derivatives develop normally .
The specific expression of rost in muscle founder cells suggests it may play a role in the founder cell-specific aspects of fusion. The fusion process in Drosophila involves the recognition between founder cells (which determine the identity of the future muscle) and fusion-competent myoblasts. The presence of rost in founder cells indicates it may be involved in:
Recognizing appropriate fusion-competent myoblasts
Initiating the adhesion process
Facilitating membrane fusion events
Mediating signaling events that lead to successful fusion
To further investigate this relationship, researchers could perform cell-type-specific knockdown or overexpression of rost in either founder cells or fusion-competent myoblasts and observe the effects on fusion events. Additionally, live imaging of rost-GFP fusion proteins during myoblast fusion could provide insights into its dynamics during the fusion process .
While specific information about post-translational modifications (PTMs) of rost protein is limited in the provided search results, this represents an important area for future research. As a transmembrane protein involved in cell-cell fusion, rost likely undergoes various PTMs that regulate its activity, localization, and interactions.
Potential PTMs that may regulate rost function include:
Phosphorylation: Could regulate rost activity in response to signaling events that trigger fusion
Glycosylation: May affect protein stability or interactions at the cell surface
Ubiquitination: Could regulate protein turnover and temporal expression
Palmitoylation: May influence membrane association and localization within membrane microdomains
To investigate these PTMs, researchers could employ mass spectrometry-based proteomics approaches to identify modification sites on purified rost protein. Site-directed mutagenesis of potential modification sites followed by functional assays would help determine the importance of specific PTMs for rost function.
The transmembrane nature of rost suggests that proper localization is critical for its function. Experimental approaches such as subcellular fractionation or immunofluorescence microscopy with domain-specific antibodies could provide insights into how PTMs affect rost trafficking and membrane integration .
Recombinant rost protein provides an opportunity to develop in vitro assays for studying myoblast fusion. These assays could be valuable for dissecting the molecular mechanisms of fusion and for screening potential modulators of this process. To develop such assays, researchers could:
Incorporate purified rost protein into liposomes to study its membrane fusion properties.
Create cell lines expressing recombinant rost in systems where fusion does not normally occur, to determine if rost is sufficient to promote fusion.
Develop bead-based assays where rost-coated beads are used to study interactions with myoblasts or other fusion-competent cells.
Establish microfluidic platforms to visualize rost-mediated interactions between cells under controlled conditions.
Utilize surface plasmon resonance or other binding assays to identify potential interacting proteins or molecules.
For these applications, the recombinant His-tagged rost protein expressed in E. coli and purified to >90% purity would be suitable, though researchers should ensure proper protein folding and functionality after reconstitution . Such in vitro assays would complement in vivo studies and could accelerate the discovery of the molecular mechanisms underlying myoblast fusion.
The evolutionary aspects of rost function represent an intriguing area for future research. At the time of the initial characterization, no homologous genes to rost had been described. This suggests several possibilities:
Rost may represent a highly specialized protein that evolved specifically in insects for their unique mode of myoblast fusion.
Functional homologs may exist in other species despite low sequence similarity, serving similar roles in membrane fusion events.
The fusion machinery may have evolved differently across lineages, with distinct proteins fulfilling similar functions.
To address these questions, researchers could:
Perform updated sequence homology searches using current databases and more sensitive algorithms
Look for structural rather than sequence homologs
Conduct functional complementation studies where potential homologs from other species are expressed in rost mutant Drosophila
Compare the molecular mechanisms of myoblast fusion across different model organisms
Understanding the evolutionary context of rost would provide insights into the conservation of fundamental cellular processes like membrane fusion across species. It might also reveal alternative strategies that have evolved to accomplish similar developmental outcomes in different organisms .
CRISPR/Cas9 genome editing offers powerful approaches to advance our understanding of rost function beyond the traditional mutant analysis. Researchers could implement the following strategies:
Generate precise mutations in specific domains of the rost protein to determine their functional importance, moving beyond the all-or-nothing approach of traditional mutants.
Create fluorescent protein fusions at the endogenous locus to visualize rost localization and dynamics during fusion events without overexpression artifacts.
Implement conditional knockout systems (e.g., using Gal4-UAS with Cas9) to disrupt rost function in specific tissues or at specific developmental timepoints.
Perform genome-wide CRISPR screens in Drosophila cells to identify genes that interact with rost, potentially revealing new components of the fusion machinery.
Generate humanized rost variants by replacing domains with sequences from potential human homologs to test functional conservation.
Create allelic series of mutations that partially disrupt rost function, allowing for the identification of hypomorphic phenotypes that might reveal additional roles beyond complete fusion failure.
These approaches would provide more nuanced insights into rost function than the original P-element-induced mutations and could help resolve questions about the specific role of rost in different steps of the fusion process .
Proper handling and storage of recombinant rost protein are crucial for maintaining its stability and functionality in research applications. Based on available information, the following guidelines are recommended:
Reconstitution protocol:
Briefly centrifuge the vial before opening to bring contents to the bottom
Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Add glycerol to a final concentration of 5-50% (50% is recommended as default)
Aliquot for long-term storage
Storage recommendations:
Store at -20°C/-80°C upon receipt
Aliquoting is necessary to avoid repeated freeze-thaw cycles
Working aliquots can be stored at 4°C for up to one week
Repeated freezing and thawing should be avoided
Buffer conditions:
Following these guidelines will help ensure the integrity of the recombinant rost protein for experimental applications. The high purity of the recombinant protein (>90% as determined by SDS-PAGE) makes it suitable for a wide range of biochemical and cellular assays investigating rost function.
Interpreting myoblast fusion phenotypes in rost mutants presents several challenges that researchers should consider:
Distinguishing primary from secondary effects: The fusion defect observed in rost mutants could be a direct result of rost's role in fusion or a secondary consequence of other cellular defects. Careful temporal analysis of the fusion process is needed to determine which steps specifically require rost function.
Phenotypic variability: Not all muscles are equally affected in rost mutants. While the body wall musculature shows severe fusion defects, some somatic muscles, the visceral mesoderm, and heart mesoderm develop normally. Understanding this differential requirement for rost requires careful analysis across different muscle types .
Redundancy in fusion pathways: Multiple genes (mbc, blow, Drac1) contribute to myoblast fusion, suggesting redundancy or parallel pathways. The specific contribution of rost to these pathways can be difficult to disentangle without detailed molecular interaction studies .
Cell-type-specific effects: Rost is expressed in both the nervous system and mesoderm. While antisense experiments have confirmed the importance of mesodermal expression, potential roles in the nervous system or in communication between neurons and developing muscles need careful investigation .
Technical limitations in visualizing fusion events: Live imaging of fusion events at high temporal and spatial resolution is technically challenging but necessary to fully understand the dynamics of rost function during fusion.
Addressing these challenges requires a combination of genetic, cellular, and biochemical approaches, as well as the development of new tools for visualizing fusion events with high precision.
When researchers encounter contradictory results regarding rost function, several methodological approaches can help reconcile these discrepancies:
Genetic background analysis: Variations in genetic background can influence phenotypic expression. Researchers should ensure mutant lines are backcrossed to a common background or use multiple independent alleles to confirm results.
Allele-specific effects: Different mutations in the rost gene might affect different protein domains or expression levels. Characterizing the molecular nature of each mutation (null, hypomorph, dominant-negative) is crucial for interpreting phenotypic differences.
Tissue-specific rescue experiments: Expressing wild-type rost in specific tissues in a mutant background can help resolve where rost function is required. For example, the expression of antisense rost transcript specifically in the mesoderm confirmed the importance of mesodermal expression for myoblast fusion .
Temporal control of gene expression: Using temperature-sensitive alleles or inducible expression systems can help determine when rost function is required and resolve contradictions that might arise from different developmental timing.
Quantitative phenotype analysis: Moving beyond qualitative descriptions to quantitative analysis of fusion events, protein localization, or biochemical activities can help identify subtle differences that explain seemingly contradictory results.
Controlling for experimental variables: Standardizing experimental conditions, including temperature, genetic background, and developmental staging, is essential for obtaining reproducible results across different laboratories.
By implementing these approaches, researchers can work toward a more cohesive understanding of rost function and resolve apparent contradictions in the scientific literature.