Recombinant Drosophila melanogaster Protein ST7 homolog (CG3634)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Drosophila melanogaster Protein ST7 homolog (CG3634) is a protein that, in fruit flies, is tagged with N-terminal His and expressed in E. coli . It is also known as Protein ST7 homolog and is associated with the gene name CG3634 . The full-length protein consists of 537 amino acids .

Table: Recombinant Drosophila Melanogaster Protein ST7 Homolog(Cg3634) Protein, His-Tagged

CategoryDetails
Cat.No.RFL33179DF
Product OverviewRecombinant Full Length Drosophila melanogaster Protein ST7 homolog(CG3634) Protein (Q9VPB1) (1-537aa), fused to N-terminal His tag, was expressed in E. coli.
SpeciesDrosophila melanogaster (Fruit fly)
SourceE.coli
TagHis
Protein LengthFull Length (1-537)
FormLyophilized powder
AA SequenceMWDSSMFLSTLTPKFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSINHISPWINGSDGQSESSNGSGSSSSSGSSSSSNGGAGGGGSGGAGASGSGSATTSTGTQMPECKVWRNPLNLFRGAEYQRFFWATSKEPLTYYDMNLSAQDHQTFFTCEGDARKEEYEIMQTAWRERNPMQRIKSAHSALEINAECAPAYILLAEEEAMTIMEAEKILKTALKVAEINYRKSQATQHQGAIADGMHRRDTNVLIYIKRRLAMCARKLGKLKEAAKMFRDLTKEIPSIMSVLNIHENLIETLLEMQAYADCHAILAKYDDISLPKSATICYTAALLKARAVADKFSPDIASKRGLSQAEMSAVEAIHRAVEFNPHVPKYLLETKRLILPPEHILKRGDSEALAYAFFHLKHWKQVEGALNLLHCTWEGTFRMLPYPLERGHLFYPYPTCTECADRELLPAFHEVSVYPKKELPFFILFTAGLCSITALLALATHQYPEPMGHLAQTVLTWISYPFQLLKERIEAFWPCNLLQQLSRV
PurityGreater than 90% as determined by SDS-PAGE.
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Gene NameCG3634
SynonymsCG3634; Protein ST7 homolog
UniProt IDQ9VPB1

Function and Pathways

CG3634 participates in various pathways and has several biochemical functions . These functions can be performed independently or in cooperation with other proteins . This protein also interacts directly with other proteins and molecules, as detected through methods like yeast two-hybrid assays, co-immunoprecipitation, and pull-down assays .

Homology

Research indicates that CG7630 in Drosophila melanogaster shares functional homology with human COX7B, a subunit of cytochrome c oxidase (COX) . Although sequence similarity is low, computational reconstruction suggests similar secondary and tertiary structures, particularly a hydrophobic transmembrane helix and conserved residues for interaction with the COX4 subunit .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CG3634; Protein ST7 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-537
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG3634
Target Protein Sequence
MWDSSMFLSTLTPKFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSINHISPWING SDGQSESSNGSGSSSSSGSSSSSNGGAGGGGSGGAGASGSGSATTSTGTQMPECKVWRNP LNLFRGAEYQRFFWATSKEPLTYYDMNLSAQDHQTFFTCEGDARKEEYEIMQTAWRERNP MQRIKSAHSALEINAECAPAYILLAEEEAMTIMEAEKILKTALKVAEINYRKSQATQHQG AIADGMHRRDTNVLIYIKRRLAMCARKLGKLKEAAKMFRDLTKEIPSIMSVLNIHENLIE TLLEMQAYADCHAILAKYDDISLPKSATICYTAALLKARAVADKFSPDIASKRGLSQAEM SAVEAIHRAVEFNPHVPKYLLETKRLILPPEHILKRGDSEALAYAFFHLKHWKQVEGALN LLHCTWEGTFRMLPYPLERGHLFYPYPTCTECADRELLPAFHEVSVYPKKELPFFILFTA GLCSITALLALATHQYPEPMGHLAQTVLTWISYPFQLLKERIEAFWPCNLLQQLSRV
Uniprot No.

Target Background

Database Links

KEGG: dme:Dmel_CG3634

UniGene: Dm.5938

Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are recommended storage conditions for recombinant CG3634 protein?

For optimal stability of recombinant CG3634 protein, the following storage conditions are recommended:

  • Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • Store in buffer conditions optimized for stability:

    • Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • Alternative formulation: Tris-based buffer with 50% glycerol

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50%

When preparing the protein for experiments, briefly centrifuge the vial before opening to bring contents to the bottom, especially when dealing with lyophilized preparations .

What are the optimal expression systems for producing recombinant CG3634 protein?

Multiple expression systems have been successfully used to produce recombinant CG3634, each with particular advantages:

Expression SystemKey FeaturesConsiderationsSource Evidence
E. coli- High yield
- N-terminal His-tag fusion
- Full-length expression (1-537aa)
- May require optimization of codon usage
- Potential for inclusion body formation
Yeast- Post-translational modifications
- Possible secretion strategies
- Lower yield than bacterial systems
- Longer production time
Baculovirus- More complex eukaryotic processing
- Good for larger proteins
- Requires specialized facilities
- Higher cost
Mammalian cells- Most authentic modifications
- Proper protein folding
- Highest cost
- Most complex system to establish

For E. coli expression specifically, successful protocols have produced full-length protein (1-537aa) fused to an N-terminal His tag with purity greater than 90% as determined by SDS-PAGE . This suggests that despite the relatively large size of the protein, bacterial expression is viable and can produce high-quality material suitable for biochemical and structural studies.

What purification strategies yield highest purity recombinant CG3634 protein?

Purification of recombinant CG3634 requires strategic approaches based on the expression system and desired applications:

  • Affinity Chromatography:

    • For His-tagged protein: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resin

    • Optimization of imidazole concentrations in binding buffer (10-20 mM) and elution buffer (250-500 mM)

    • Use of EDTA-free protease inhibitors to prevent metal chelation

  • Secondary Purification Steps:

    • Size exclusion chromatography to separate monomeric protein from aggregates

    • Ion exchange chromatography based on the theoretical pI of CG3634

    • Hydrophobic interaction chromatography as necessary for removal of contaminants

  • Quality Control Metrics:

    • SDS-PAGE analysis with target purity >90%

    • Western blotting with anti-tag antibodies

    • Mass spectrometry for confirmation of protein identity

    • Dynamic light scattering to assess homogeneity

This multi-step purification strategy can effectively isolate CG3634 protein at purities suitable for biochemical analysis, structural studies, and antibody production.

How can recombinant CG3634 protein be used to investigate chromosome cohesion and segregation in Drosophila?

The study of chromosome cohesion and segregation mechanisms in Drosophila can be advanced using recombinant CG3634 through several experimental approaches:

  • Genetic Interaction Studies:

    • Test interactions between CG3634 mutants and known components of chromosome segregation machinery

    • Use established chromosome missegregation models like the GMR>Rad21NC system, which produces a reduced and disorganized eye phenotype when a non-cleavable form of the cohesin component Rad21 is expressed

    • Quantify enhancement or suppression of phenotypes to position CG3634 within regulatory networks

  • Cytological Analysis:

    • Neuroblast squash experiments can visualize mitotic chromosomes and detect abnormalities

    • Analysis of tetraploidy, aneuploidy, lagging chromosomes, and chromosome fragments

    • Time-lapse imaging of fluorescently-tagged CG3634 during cell division

  • Biochemical Approaches:

    • Pull-down assays using purified recombinant CG3634 to identify interacting partners

    • Co-immunoprecipitation with cohesin components and other segregation machinery

    • In vitro binding assays to test direct interactions

A recent genetic screen identified 133 candidate loci capable of modifying a chromosome missegregation phenotype, providing a framework for positioning CG3634 within this complex network . The screen utilized mutant alleles within deletion breakpoints previously identified as modifiers of the GMR>Rad21NC model, highlighting the molecular complexity of chromosome segregation processes.

What methodologies can be used to develop specific antibodies against CG3634 for immunolocalization studies?

Developing effective antibodies against CG3634 for immunolocalization studies involves several strategic approaches:

  • Antigen Selection and Preparation:

    • Full-length protein approach: Use purified recombinant CG3634 from E. coli or yeast expression systems

    • Peptide approach: Select 15-20 amino acid peptides from hydrophilic, surface-exposed regions of CG3634

    • Strategic epitope targeting: Develop antibodies against both N-terminal and C-terminal regions to ensure detection of potential protein fragments

  • Immunization and Antibody Production:

    • Polyclonal antibodies: Immunize rabbits with purified His-tagged CG3634 protein using standard protocols (primary immunization + 3-4 boosts)

    • Monoclonal antibodies: Generate hybridomas following mouse immunization for applications requiring higher specificity

    • Purification strategies: Affinity purification against immobilized recombinant protein for highest specificity

  • Validation for Immunolocalization:

    • Western blot analysis: Test against recombinant protein and Drosophila tissue lysates

    • Control experiments:

      • Pre-adsorption with antigen

      • Testing in CG3634 knockdown/knockout tissues

      • Peptide competition assays

    • Optimization for microscopy: Test multiple fixation methods (paraformaldehyde, methanol) and permeabilization conditions

  • Advanced Applications:

    • Co-localization studies: Combine with markers for cellular compartments

    • Super-resolution microscopy: Optimize antibodies for STED or STORM imaging

    • Electron microscopy: Develop immunogold labeling protocols for ultrastructural localization

The availability of recombinant CG3634 with different tags provides flexibility for developing and validating highly specific antibodies suitable for diverse research applications.

How can CRISPR/Cas9 genome editing be applied to study CG3634 function in Drosophila?

CRISPR/Cas9 genome editing offers powerful approaches for investigating CG3634 function in Drosophila:

  • Gene Knockout Strategies:

    • Design sgRNAs targeting coding regions of CG3634

    • Engineer frameshift mutations through non-homologous end joining (NHEJ)

    • Create precise deletions of functional domains using dual sgRNAs

    • Screen for mutations using T7 endonuclease assays or direct sequencing

  • Knock-in Applications:

    • Insert fluorescent tags (GFP/RFP) for live visualization of protein dynamics

    • Engineer specific point mutations to test structure-function relationships

    • Create conditional alleles using FRT sites or LoxP sequences

    • Introduce epitope tags for immunoprecipitation and ChIP experiments

  • Regulatory Element Modification:

    • Target promoter or enhancer regions to alter expression patterns

    • Engineer inducible expression systems

    • Create reporter constructs to monitor transcriptional regulation

  • Phenotypic Analysis Pipeline:

    • Developmental analysis: Viability, morphology, timing of development

    • Cellular phenotypes: Chromosome segregation, cell cycle progression

    • Adult behaviors: Locomotion, reproduction, lifespan

The resulting mutant lines can be used in genetic interaction studies with the chromosome missegregation models described in previous research , or incorporated into the quantitative genomics frameworks outlined for space-related research .

What insights can recombinant inbred line (RIL) panels provide about CG3634's role in adaptive traits?

Recombinant inbred line (RIL) panels offer powerful tools for investigating CG3634's potential roles in adaptive traits:

  • Genetic Architecture Analysis:

    • Map quantitative trait loci (QTLs) affecting phenotypes potentially linked to CG3634 function

    • Recent research using Drosophila RIL panels has identified 14 QTLs underlying adaptive traits including melanism, wing size, and stress resistance

    • These studies demonstrate that the genetic architecture of adaptive traits often involves alleles of detectable effect

  • Gene-by-Environment Interactions:

    • Test CG3634 variants under different environmental conditions

    • Recent findings show that while strong epistasis (gene-by-gene interactions) was not ubiquitous in adaptive trait evolution, gene-by-environment interactions significantly modulated the effect size of adaptive alleles

    • This framework can be applied to understand CG3634's potential role in environmental adaptation

  • Experimental Approaches:

    • Use RIL panels with sequenced genomes to correlate CG3634 variants with phenotypic outcomes

    • Implement additive genetic models for accurate QTL mapping, as demonstrated in recent studies

    • Combine mapping results with population genetic statistics to identify potential new gene functions

  • Multi-Generational Studies:

    • Investigate potential roles of CG3634 in transgenerational effects

    • Recent research has examined how maternal age alters recombination rates in Drosophila , providing methodological approaches applicable to studying CG3634's potential role in inheritance patterns

These approaches can reveal whether CG3634 contributes to adaptive traits and how its function might be modulated by environmental factors, providing deeper understanding of its biological significance.

How might CG3634 contribute to spaceflight adaptation in Drosophila?

CG3634's potential role in spaceflight adaptation can be investigated through specialized experimental designs leveraging Drosophila's advantages as a model organism:

  • Spaceflight Experimental Platforms:

    • Utilize established hardware systems for Drosophila experiments in space environments

    • The Multi-use Variable-gravity Platform (MVP) can support thousands of adult flies and tens of thousands of eggs and larvae across three consecutive generations

    • Each MVP contains two centrifuges with 12 modules each, allowing for controlled gravity experiments

  • Quantitative Genomics Approaches:

    • Single-generation analysis: Test whether CG3634 variants affect survival in space environments

    • Use the Advanced Intercross Population (AIP) to identify genetic variants conferring adaptation

    • Compare experimental samples with Earth-reared controls to identify allele frequency changes

  • Multi-Generational Studies:

    • Track CG3634 expression and genetic changes across generations in space

    • For each generation reproduced, preserve 200 male and 200 female parents for DNA, RNA, and ATAC sequencing upon return to Earth

    • Assess quantitative traits including stress resistance, behaviors, and fitness parameters

  • Environmental Variable Testing:

    • Compare effects under simulated 1g gravity on the ISS to isolate radiation effects

    • Test titrated gravity conditions simulating Lunar or Martian environments

    • Analyze CG3634 expression changes in response to specific spaceflight stressors

Previous spaceflight experiments with Drosophila have demonstrated alterations in immune responses, cardiac functioning, germline mutations, and neuronal/metabolic changes , providing context for investigating CG3634's potential involvement in space adaptation mechanisms.

How does CG3634 interact with repetitive DNA elements in the Drosophila genome?

The interaction between CG3634 and repetitive DNA elements represents an intriguing research direction, especially given Drosophila's unique genomic architecture:

  • Genomic Context Analysis:

    • Drosophila genomes contain large clusters of densely spaced, short (≤1 kb) moderately repetitive elements

    • Different clusters contain many of the same repetitive elements arranged differently, creating a complex genomic landscape

    • ChIP-seq experiments could investigate whether CG3634 associates with these clustered repetitive regions

  • Experimental Approaches:

    • Chromatin immunoprecipitation followed by high-throughput sequencing (ChIP-seq) using CG3634 antibodies

    • DNA adenine methyltransferase identification (DamID) using CG3634-Dam fusion proteins

    • Fluorescence in situ hybridization (FISH) to visualize co-localization with specific repetitive elements

  • Functional Implications:

    • Studies have shown that repetitive elements in Drosophila occur in euchromatic regions and account for a large fraction of moderately repetitive DNA

    • Repetitive elements have been identified throughout a 9 kb region neighboring heat shock genes, throughout introns of major rDNA repeats, and within transposable elements

    • Investigation of CG3634 association with these regions could reveal roles in chromatin organization or transcriptional regulation

  • Technical Considerations:

    • Two-dimensional Southern blotting techniques can detect clustered arrangements and analyze fine structure

    • Hybridization to polytene chromosomes can map chromosomal locations of CG3634-associated repetitive elements

This research direction could reveal novel functions of CG3634 in genome organization and potential roles in regulating repetitive element activity, which has implications for genome stability and expression regulation.

What role might CG3634 play in complex behavioral phenotypes in Drosophila?

Recent genetic screening has revealed connections between gene expression and complex behaviors in Drosophila, providing a framework for investigating CG3634's potential involvement:

  • Behavioral Paradigm Development:

    • Recent research has identified genes associated with male-male social interactions that impact transcriptional regulation of aggression and mating behavior

    • Specific protocols can test for alterations in mating duration (LMD) and copulation latency when CG3634 is manipulated

    • These behavioral assays provide sensitive readouts of gene function in complex behaviors

  • Cell-Type Specific Analysis:

    • Single-cell RNA-sequencing has revealed that behavior-related genes are co-expressed with male-specific genes in specific cell populations, particularly cone cells

    • Testing whether CG3634 is expressed in these specialized cell types could reveal potential roles in behavior

    • Cone cell-specific manipulation of CG3634 expression can test for behavioral effects

  • Experimental Approaches:

    • RNAi-mediated knockdown of CG3634 in specific cell types using the UAS-GAL4 system

    • Overexpression studies to test for gain-of-function effects on behavior

    • CRISPR/Cas9-mediated mutation of CG3634 followed by behavioral phenotyping

  • Integration with Known Pathways:

    • Recent studies have identified genes like Cyp6a20, Cyp4d21, CrzR, and the novel gene CG10026/Macewindu as regulators of mating duration when expressed in cone cells

    • Testing for genetic interactions between CG3634 and these established regulators could position it within behavioral regulatory networks

This research direction could reveal unexpected roles for CG3634 in complex behaviors, potentially through non-neuronal mechanisms, as demonstrated by the critical role of cone cells in regulating mating behavior .

What are the most promising future research directions for CG3634 studies?

Based on the current state of knowledge, several high-priority research directions emerge for CG3634:

  • Functional Characterization:

    • Determine subcellular localization using fluorescently-tagged versions

    • Identify interacting partners through proteomics approaches

    • Establish phenotypic consequences of loss-of-function and gain-of-function mutations

    • Investigate potential roles in chromosome dynamics suggested by genetic screening data

  • Evolutionary Analysis:

    • Compare function with homologs in other species

    • Analyze selective pressures acting on different protein domains

    • Test for functional conservation through cross-species rescue experiments

    • Recent recombinant inbred line studies provide methodological frameworks for such evolutionary investigations

  • Space Biology Applications:

    • Test CG3634 expression changes under spaceflight conditions

    • Examine potential roles in adaptation to space environments

    • Implement the quantitative genomics approaches outlined for spaceflight research

    • Investigate multigenerational effects in altered gravity environments

  • Structure-Function Relationships:

    • Determine three-dimensional structure through X-ray crystallography or cryo-EM

    • Map functional domains through mutagenesis

    • Identify post-translational modifications and their functional significance

    • The availability of recombinant protein expression systems facilitates these structural studies

These research directions leverage the genetic tractability of Drosophila and the availability of recombinant CG3634 protein to address fundamental questions about its biological functions and potential applications in diverse research contexts.

How can integration of multiple 'omics approaches advance understanding of CG3634 function?

An integrated multi-omics strategy can provide comprehensive insights into CG3634 function:

  • Combined Genomics and Transcriptomics:

    • Expression QTL (eQTL) mapping to identify genetic variants affecting CG3634 expression

    • Recent studies have built sex-specific pleiotropic cis-trans transcriptional regulatory networks in Drosophila

    • These networks include novel transcripts that are likely long non-coding RNAs, which could interact with CG3634

  • Integration with Proteomics and Metabolomics:

    • Correlation of CG3634 expression with global proteomic changes

    • Metabolic pathway analysis to identify functional consequences of CG3634 modulation

    • Protein-protein interaction networks to position CG3634 within cellular pathways

  • Epigenomic Connections:

    • ATAC-seq to analyze chromatin accessibility changes associated with CG3634 function

    • ChIP-seq to identify binding sites if CG3634 has DNA-binding properties

    • Investigation of potential roles in chromatin organization, especially in relation to repetitive DNA elements

  • Multi-generational Effects:

    • Combined genomic, transcriptomic, and epigenomic analyses across generations

    • This is particularly relevant for space biology research, where multi-generational experiments using Drosophila would further understanding of spaceflight effects on reproduction, epigenetic signatures, and genetic effects on future generations

This integrated approach can reveal CG3634's function within complex cellular networks and provide insights that would not be apparent from any single methodology, advancing our understanding of this protein's biological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.