Recombinant Drosophila melanogaster Protein TAPT1 homolog (CG7218)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific requirement for the format, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
CG7218; Protein TAPT1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-676
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG7218
Target Protein Sequence
MNATLNSAGGKRQLRFRGDVTGSRVEELHHQQQEEQKQKAPLAQDDVAATPTATPAAGSA QQRLQSGTAETCTNTFYDFFKVEMTRGYMLEHDEERYSARRQKIYSFMRIPRDLERFMVY GIMQCADSFLYIHTFLPVRFVMAVWALVSRTVARIFRLRSSGQRLLSPAEICDLLKGVIW MTVTLIMLLVDTNRVYHIIKSQSIIKLYIFYNMLEVGDRLLSAFGQDTIDALFWTATEPK NSKREHFGVLTHVLFTLIYVFLHSGLIMFQATCLNVAVNSNNKGLLTIMISNNFVELKGS VFKKFDKNNLFQLTCSDVRERFHLSVLLFIVVIQTMKEFDWSITQFCVMLPDCFAVLFTE ILIDWVKHAFITRFNELPESIYREYTTSLAYDMTQTRQKHAFSDHSDLVARRMGFIPFPL AVVLIKAIYTAVSFENLAAWLLFLLAYLFAMGLRICLTICALGKACKLMKEHQTERNSST PSSMTNVPVIGAAAPVSAAATGGQNHNNNNNNNNNSISIGSKPAQVTTLLTPPSAGHLDV SKNFSRTSIASTSTPKKAVSEQELDVTNSLELGATALFSNSDVDLDDVCLNEQVTNTNTS SAVQEVYQEQDLVRSQPDLMLLNNSGDGVTSAKAKKATQRLPKRTHKRSESEPGMPSMVE KGGAAGIAGGNQTTQL
Uniprot No.

Target Background

Database Links

KEGG: dme:Dmel_CG7218

UniGene: Dm.4325

Protein Families
TAPT1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the Drosophila melanogaster Protein TAPT1 homolog (CG7218)?

The TAPT1 homolog in Drosophila melanogaster is a 676-amino acid transmembrane protein encoded by the CG7218 gene. It has been identified with UniProt accession number Q9VED0. While its specific function remains under investigation, it shares homology with the mammalian TAPT1 (Transmembrane Anterior Posterior Transformation 1) protein, suggesting potential roles in developmental processes and cellular organization .

What specifications should researchers know about the recombinant TAPT1 homolog protein?

When working with the recombinant form, researchers should be aware of the following specifications:

ParameterSpecification
SpeciesDrosophila melanogaster (Fruit fly)
SourceE. coli
TagHis
Protein LengthFull Length (1-676)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Gene NameCG7218
UniProt AccessionQ9VED0

The recombinant protein typically includes an N-terminal His-tag to facilitate purification and detection .

What are the optimal storage and handling conditions for this recombinant protein?

For optimal protein stability and activity:

  • Store the protein at -20°C/-80°C upon receipt

  • Aliquot the protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

What genetic approaches can be used to study TAPT1 homolog function in Drosophila?

Multiple genetic strategies can be employed to investigate TAPT1 homolog function:

  • RNA interference (RNAi): Similar to approaches used for studying genes like dTrpA1, RNAi-mediated knockdown can assess loss-of-function phenotypes. This technique targets specific mRNA for degradation, reducing protein expression .

  • CRISPR-Cas9 gene editing: This method allows precise modification of the CG7218 gene to create knockout lines or introduce specific mutations.

  • GAL4/UAS system integration: By creating a CG7218-GAL4 driver line, researchers can express UAS-controlled transgenes in cells that naturally express TAPT1 homolog, enabling cell-specific rescue experiments or manipulations .

  • T2AGAL4 cassette insertion: For genes with suitable introns, an artificial exon containing T2AGAL4 can be inserted to monitor gene expression patterns while maintaining endogenous protein function .

How can gene tagging techniques be optimized for studying TAPT1 homolog?

Recent advancements in Drosophila gene tagging provide powerful tools for studying TAPT1 homolog:

  • If CG7218 contains suitable coding introns, an artificial exon with a T2AGAL4 cassette can be inserted using CRISPR-mediated homologous recombination

  • For genes lacking suitable introns (approximately 58% of Drosophila genes), newer constructs allow replacement of the coding region with a KozakGAL4 cassette, generating a knock-out/knock-in allele that expresses GAL4 in the endogenous expression pattern

  • Short homology arms (100-200 bps) can now be used for donor constructs, making it feasible to commercially synthesize homology donors and minimize cloning steps

  • Custom vector backbones containing the target gene sgRNA improve transgenesis efficiency by eliminating the need for a separate sgRNA plasmid, increasing success rates to 70-80%

What challenges exist in expressing full-length TAPT1 homolog in heterologous systems?

Researchers face several challenges when expressing this protein:

  • Membrane protein expression: As a transmembrane protein, TAPT1 homolog requires proper membrane insertion and folding to maintain its native structure.

  • Expression system selection: While E. coli can produce the protein (as evidenced by the commercial availability of E. coli-expressed recombinant protein), eukaryotic expression systems might better preserve post-translational modifications and proper folding .

  • Purification complexity: Membrane proteins require specialized purification protocols, often involving detergent solubilization while maintaining structural integrity.

  • Tag placement considerations: While the His-tag facilitates purification, its position (N-terminal versus C-terminal) may affect protein function depending on the structural constraints of the protein .

How does TAPT1 homolog relate to other well-characterized Drosophila proteins?

Understanding TAPT1 homolog in context with other Drosophila proteins provides valuable research insights:

  • Unlike characterized proteins such as dTRPA1 (which functions as a heat-activated ion channel essential for thermotaxis), the specific functions of TAPT1 homolog remain less well defined .

  • Comparative analysis with proteins of known function can help predict possible roles. For example, if TAPT1 homolog shares pathway components with dTRPA1, experimental approaches similar to those used in thermotaxis studies might be informative .

  • Genetic interaction studies using the Drosophila genetic toolkit could identify functional relationships with other developmentally important proteins .

What strategies can be used to determine the expression pattern of TAPT1 homolog?

Several complementary approaches can reveal TAPT1 homolog expression patterns:

  • Antibody-based detection: Developing antibodies against the TAPT1 homolog enables immunohistochemistry to visualize protein localization in tissues.

  • Fluorescent reporter fusion: Creating transgenic flies with TAPT1-GFP fusion proteins allows live imaging of expression patterns.

  • GAL4 knock-in approaches: Replacing the coding region with a KozakGAL4 cassette generates a driver line that expresses GAL4 in the same pattern as the endogenous gene, which can then activate UAS-GFP to visualize expression .

  • RNA in situ hybridization: This technique can visualize the spatial distribution of TAPT1 homolog mRNA in different tissues and developmental stages.

The choice depends on research questions, available resources, and whether protein or mRNA localization is of primary interest.

How can polytene chromosome analysis be integrated into TAPT1 homolog research?

Drosophila polytene chromosomes provide unique opportunities for cytogenetic analysis:

  • Chromosome localization: Using polytene chromosome spreads from larval salivary glands can help confirm the genomic location of the CG7218 gene.

  • Chromatin state analysis: Staining with acetocarmine allows visualization of chromatin banding patterns and potential identification of regulatory regions.

  • Preparation protocol: Isolate salivary glands from third instar larvae, place on a slide with a drop of NaCl solution, apply acetocarmine stain, and cover with a coverslip for microscopic examination .

  • Enhancer-trap integration: When combined with gene tagging approaches, polytene chromosome analysis can confirm proper integration of reporter constructs at the CG7218 locus.

How should researchers analyze phenotypic data from TAPT1 homolog mutants?

  • Chi-square analysis: When analyzing genetic crosses involving TAPT1 homolog mutants, chi-square tests can determine whether observed phenotypic ratios match expected Mendelian inheritance patterns .

  • Sample size considerations: Collect data from multiple independent crosses over several days to accumulate statistically significant results. The more data accumulated, the more significant the results .

  • Control selection: Include appropriate genetic background controls to distinguish phenotypes specifically associated with TAPT1 homolog disruption versus general genetic background effects.

  • Penetrance and expressivity: Document variation in phenotypic manifestation, as many developmental phenotypes show incomplete penetrance or variable expressivity.

What bioinformatic approaches can predict TAPT1 homolog function?

Computational analyses provide valuable insights:

  • Sequence homology analysis: Compare the TAPT1 homolog sequence across species to identify conserved domains that might indicate functional importance.

  • Protein structure prediction: Use algorithms to predict transmembrane domains, potential binding sites, and three-dimensional structure.

  • Interaction network analysis: Identify potential protein-protein interactions through database mining and co-expression data.

  • Pathway enrichment: Analyze whether genes co-expressed with TAPT1 homolog cluster in specific biological pathways to suggest potential functions.

What are the best approaches for generating TAPT1 homolog antibodies?

Antibody development requires strategic planning:

  • Epitope selection: Choose unique, surface-exposed regions of the TAPT1 homolog protein for antibody generation, avoiding transmembrane domains.

  • Fusion protein strategy: Express portions of TAPT1 homolog as fusion proteins with tags like GST or MBP to enhance solubility and immunogenicity.

  • Validation methods: Validate antibody specificity using Western blot analysis comparing wild-type and TAPT1-deficient Drosophila samples.

  • Application optimization: Determine optimal antibody dilutions and conditions for different applications (Western blot, immunoprecipitation, immunohistochemistry).

How can researchers troubleshoot expression issues with recombinant TAPT1 homolog?

Common challenges and solutions include:

  • Protein solubility: For membrane proteins like TAPT1 homolog, solubility can be enhanced by optimizing detergent conditions or using fusion partners that promote solubility.

  • Expression level optimization: Adjust induction conditions (temperature, inducer concentration, duration) to balance protein yield with proper folding.

  • Codon optimization: Consider synthesizing a codon-optimized version of the gene for the expression system being used to improve translation efficiency.

  • Protein stability assessment: Evaluate different buffer compositions and additives (like trehalose) that might enhance protein stability during storage and reconstitution .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.