Recombinant Drosophila melanogaster Protein trapped in endoderm-1 (Tre1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have readily available. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary based on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
It is advisable to briefly centrifuge this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration ranging from 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tre1; CG3171; Protein trapped in endoderm-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Tre1
Target Protein Sequence
MDQDMGMATGYFQDADMQMDEPAAATQSIYPHSATLFAAISACVFVTIGVLGNLITLLAL LKSPTIREHATTAFVISLSISDLLFCSFSLPLTAVRFFQESWTFGTTLCKIFPVIFYGNV AVSLLSMVGITLNRYILIACHSRYSQIYKPKFITLQLLFVWAVSFLLLLPPILGIWGEMG LDEATFSCTILKKEGRSIKKTLFVIGFLLPCLVIIVSYSCIYITVLHQKKKIRNHDNFQI AAAKGSSSSGGGSYMTTTCTRKAREDNRLTVMMVTIFLCFLVCFLPLMLANVVDDERNTS YPWLHIIASVMAWASSVINPIIYAASNRNYRVAYYKIFALLKFWGEPLSPMPSRNYHQSK NSKELSGVIRSTPLFHAVQKNSINQMCQTYSV
Uniprot No.

Target Background

Function
Tre1 plays a critical role in the initial active step of germ cell migration: transepithelial migration of germ cells through the posterior midgut (PMG) epithelium.
Gene References Into Functions
  1. Bifurcation of the Tre1 G protein-coupled receptor signaling response via G protein-dependent and independent branches enables distinct spatiotemporal regulation of germ cell migration. PMID: 28687666
  2. Feminizing the Tre1-expressing neurons in male flies leads to rapid courtship initiation, a phenotype that contributes to increased reproductive success. Tre1 is expressed in a sexually dimorphic pattern in olfactory sensory neurons and the central nervous system. PMID: 26721856
  3. An investigation of the role of the arginine within the NRY motif in Tre1 suggests that a salt bridge may form between this critical arginine and an aspartic acid in transmembrane alpha-helix (TM6) in Tre1. PMID: 24044607
  4. The scattershot allele, characterized by an in-frame deletion of 8 amino acids at the junction of the third transmembrane domain and the second intracellular loop of Tre1, significantly impairs the function of this GPCR in germ cell migration. PMID: 20676220
  5. Tre1 plays a significant role in regulating germ cell migration, polarity, cell adhesion, and cadherin binding. (review) PMID: 20058705
  6. Tre1 serves as a G protein-coupled receptor that directs transepithelial migration of Drosophila germ cells. PMID: 14691551
  7. Down-regulation of E-cadherin leads to germ cell dispersal but is insufficient for transepithelial migration in the absence of Tre1, suggesting a novel mechanism for Tre1 GPCR function that connects cell polarity, modulation of cell adhesion, and invasion. PMID: 18824569

Show More

Hide All

Database Links

KEGG: dme:Dmel_CG3171

STRING: 7227.FBpp0070813

UniGene: Dm.18422

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
In embryos, expression is seen at highest levels in the cuprophilic cells and at lower levels in the amnioserosa, developing CNS, cardiac mesoderm primordium and midline glia.

Q&A

What is the role of Tre1 in Drosophila germ cell migration, and how is it experimentally validated?

Tre1 orchestrates GC navigation by polarizing actin dynamics through localized PI(4,5)P₂ production and Wiskott-Aldrich syndrome protein (WASP)-mediated actin polymerization. Key experimental approaches include:

  • CRISPR/Cas9-generated null alleles: Complete Tre1 knockout (KO) alleles, such as Tre1ᴷᴼ, exhibit ~90% GC migration failure due to misorientation of F-actin protrusions .

  • Live-cell imaging: Tracking GC trajectories in Tre1ᴷᴼ mutants reveals random motility patterns, contrasting with directed migration in wild-type (WT) embryos .

  • Localization studies: Tre1 co-localizes with F-actin, PI(4,5)P₂, and dPIP5K at migration fronts, validated via immunofluorescence and tagged constructs (e.g., Tre1-GFP) .

Table 1: Phenotypic Outcomes of Tre1 Mutants

GenotypeGC Migration Defect (%)Key Molecular DefectsCitation
Tre1ᴷᴼ90%Loss of F-actin polarization, PI(4,5)P₂ mislocalization
Tre1ˢᶜᵗᵗ85%Disrupted G-protein coupling, erratic protrusions
Tre1^Δᴱᴾ⁵80%Reduced membrane localization, impaired Rho1 polarity

Which signaling pathways interact with Tre1, and how are these interactions assayed?

Tre1 integrates guidance cues from Hh signaling through Smo. Methodologies to map these interactions include:

  • Co-immunoprecipitation (Co-IP): Demonstrates physical association between Tre1 and Smo in GC lysates .

  • Pharmacological inhibition: Cyclopamine (Smo inhibitor) reduces Tre1 membrane localization, impairing F-actin polarization .

  • Genetic epistasis: Smo RNAi rescues Tre1ᴷᴼ migration defects, confirming functional interdependence .

How can researchers resolve contradictions in Tre1’s reported roles in cell adhesion vs. guidance?

Conflicting studies attribute Tre1 mutant GC dispersal to either failed adhesion dissolution or misguided motility . A tripartite analysis (TriPA) framework is recommended:

  • Case-by-case integration: Compare adhesion molecule (e.g., E-cadherin) dynamics in Tre1ᴷᴼ vs. WT GCs using time-lapse microscopy .

  • Quantitative-qualitative merging: Quantify E-cadherin fluorescence intensity and correlate with GC trajectory data .

  • Pattern recognition: Identify whether adhesion loss precedes or follows motility defects .

Table 2: Conflicting Interpretations of Tre1 Function

StudyProposed MechanismKey Evidence
Kunwar et al. (2003)Adhesion dissolutionE-cadherin downregulation in Tre1 mutants
Lin et al. (2020)Guidance cue sensingRandom Rho1/MyoII oscillations in mutants
Kim et al. (2021)PI(4,5)P₂-dependent polarizationTre1-dPIP5K co-localization at protrusions

What methodologies optimize detection of Tre1 in vivo, given its low expression and rapid turnover?

Tre1’s transient membrane localization necessitates:

  • Stabilized tagged constructs: Tre1-GFP (half-life >6 hrs) outperforms Tre1-FLAG/HA in pulse-chase assays .

  • Cycloheximide treatment: Confirms Tre1-GFP resistance to degradation in S2R+ cells .

  • Super-resolution microscopy: Resolve Tre1 nanodomains at protrusions using STED or PALM .

How can multi-omics data be integrated to map Tre1’s regulatory network?

A multi-tiered approach is critical:

  • Transcriptomics: RNA-seq of Tre1ᴷᴼ GCs identifies downstream effectors (e.g., dWIP, Rho1) .

  • Proteomics: AP-MS reveals Tre1 interactors (dPIP5K, Smo) .

  • Lipidomics: MALDI-TOF detects PI(4,5)P₂ spatial gradients in migrating GCs .

What controls are essential for Tre1 loss-of-function studies?

  • Maternal-zygotic mutants: Distinguish maternal vs. zygotic Tre1 contributions .

  • Rescue assays: Express tagged Tre1 in mutants to confirm phenotype reversibility .

  • Off-target controls: Use dual sgRNAs in CRISPR to exclude false positives .

How should researchers address partial penetrance in Tre1 mutant phenotypes?

  • Quantitative motility metrics: Track GC speed, directionality, and protrusion dynamics using Fiji/ImageJ .

  • Environmental standardization: Control embryo staging and incubation temperature to reduce variability .

  • Statistical modeling: Apply mixed-effects models to account for clutch-to-clutch variation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.