Recombinant Drosophila melanogaster Protein wntless (wls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your requirements; we will prioritize developing your specified tag.
Synonyms
wls; evi; srt; CG6210; Protein wntless; Evenness interrupted; Sprinter
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-594
Protein Length
Full Length of Mature Protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
wls
Target Protein Sequence
APLPAGHVTVLGSLCREDHARQNDTSFLLYSRGAGACIPVTREEVEQDSTKMANELVHVF QMPLPRDLRDLDYSRWQQNLIGVLQVEFGYDSSSELREPPRELQLTIDMRLAYRNKGDPD NGWKLYAHGVEHRYLDCVTSHVGPTETLYSCDMIPLFELGALHHSFYLLNLRFPLDTPSQ MNLQFGHMHDLTLTAIHQNGGFTQIWLLLKTMLFPFVVGIMIWFWRRVHLLQRSPALLEY MLIYLGAALTFLNLPLEYLSLVYEMPYMLLLSDIRQGIFYAMLLTFWLVFAGEHMLIQDA PNKSTIRSRYWKHLSAVVVGCISLFVFDICERGVQLRNPFYSIWTTPLGAKVAMTFIVLA GVSAAIYFLFLCYMIWKVFRNIGDKRTSLPSMSQARRLHYEVPLDQKVEDWAGIVYFYTK AFFFQLHKANESKGLIYRFKFLMLATLVCAALTVAGFIMGQMAEGQWDWNDNVAIQPTSA FLTGVYGMWNIYIFALLILYAPSHKQWPTMHHSDETTQSNENIVASAASEEIEFSHLPSD SNPSEISSLTSFTRKVAFD
Uniprot No.

Target Background

Function
Wntless (Wls) is a segment polarity gene crucial for wingless (wg)-dependent developmental patterning. It functions in both wg-producing and wg-responsive cells. In non-neuronal cells, Wls directs wg secretion through a trafficking pathway involving the Golgi apparatus, cell surface, an endocytic compartment, and retrograde transport back to the Golgi. This pathway utilizes clathrin-mediated endocytosis and the retromer complex (containing Vps35 and Vps26). In neuronal cells (e.g., larval motor neuron NMJs), wg signaling transverses the synapse via Wls-containing exosome-like vesicles. Postsynaptic Wls is essential for the trafficking of Frizzled 2 (fz2) through the fz2-interacting protein Grip.
Gene References Into Functions
  1. Evi5, a Drosophila protein, is a critical membrane trafficking regulator impacting border cell migration. PMID: 22778279
  2. Syx1A, Rab11, and its effector Myosin 5 are required for proper Evi vesicle release. PMID: 22437826
  3. Wntless is proposed as an ancient partner of Wnts, promoting their secretion. PMID: 16678095
  4. Wntless and the retromer complex are essential components of Wnt signaling. PMID: 18160348
  5. Wg, clathrin-mediated endocytosis, and the retromer maintain a Wls trafficking loop between the Golgi, plasma membrane, and back to the Golgi, facilitating Wnt secretion. PMID: 18193032
  6. Evi-containing vesicles transport secreted Wnt across synapses; Evi plays trafficking roles in both Wnt-producing and Wnt-receiving cells. PMID: 19837038
Database Links

KEGG: dme:Dmel_CG6210

STRING: 7227.FBpp0075947

UniGene: Dm.7728

Protein Families
Wntless family
Subcellular Location
Cell junction, synapse, presynaptic cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Note=In non-neuronal cells, wls binds to wg in the Golgi and accompanies it to the plasma membrane where the two proteins dissociate. Wg is secreted and wls is then internalized and returns to the Golgi apparatus in a retromer-dependent manner. Wls and wg colocalize in the Golgi apparatus in wg-producing cells, and reduced expression is seen in non-producing cells. Endoplasmic reticulum expression is unchanged in wg-producing versus non-producing cells. In neuronal cells, wls is localized both pre- and postsynaptically and is transferred trans-synaptically from the pre- to the postsynaptic compartment.
Tissue Specificity
Ubiquitously expressed in the wing imaginal disk, increased expression is observed in a stripe at the dorso-ventral boundary and other regions of the wing disk that express wg. Also expresses in the leg imaginal disk. During larval development, expression

Q&A

What is the structural characterization of Wntless protein?

Wntless exhibits a distinctive structural organization characteristic of transmembrane proteins. Amino acid sequence analysis predicts that Wntless contains a long N-terminal region, seven or eight transmembrane segments, and an intracellular C-terminus domain . This structural arrangement closely resembles members of the G-protein coupled receptor (GPCR) superfamily, suggesting potential evolutionary relationships or functional similarities with this well-characterized receptor class . The transmembrane domains likely create a channel or binding pocket that facilitates interaction with Wnt proteins during their intracellular transport. Understanding this structure provides fundamental insights into how Wntless physically interacts with Wnt ligands to promote their secretion from producing cells.

What is the primary function of Wntless in Drosophila melanogaster?

Wntless functions as a dedicated chaperone protein that specifically transports Wnt proteins from their site of production within cells to the plasma membrane for secretion. Research has demonstrated that Wntless is essential for Wingless-dependent patterning processes in Drosophila, as evidenced by developmental abnormalities in Wntless-deficient organisms . Importantly, Wntless appears to be selective in its activity - while it is required for all the Wnt signals analyzed, loss of Wntless function shows no effect on other signaling pathways . This functional specificity positions Wntless as an "ancient partner for Wnts dedicated to promoting their secretion into the extracellular milieu," suggesting a long evolutionary history of this protein-protein interaction that has been maintained across diverse animal species . The tissue-specific requirements for Wntless correlate directly with locations of active Wnt signaling.

How is Wntless related to the broader Wnt signaling pathway in development?

Wntless occupies a crucial position in the Wnt signaling pathway, functioning specifically in the Wnt-producing cells rather than in signal-receiving cells . The Wnt pathway itself plays pivotal roles in embryonic development across the animal kingdom, directing cell fate specification and morphogenesis in every tissue layer . In Drosophila, the primary Wnt protein Wingless (Wg) governs multiple developmental processes including wing disc patterning and follicle stem cell (FSC) proliferation . The table below summarizes key components of the Wnt pathway, highlighting Wntless's position:

Drosophila geneHuman homologActivity
winglessWNT1, 2, 2B(13), etc.Secreted signal (ligand)
porcupinePORCNO-acyltransferase
Wntless/evenness interrupted/sprinterWLSMultipass transmembrane protein, chaperone
SwimTINAG, TINAGL1Polysaccharide binding
arrowLRP5, 6Receptor
frizzled, frizzled2FZD1, 2, 3, etc.Receptor
dishevelledDVL1, 2, 3, L1?

The pathway involves complex interactions between these components, with Wntless functioning in the early secretory phase of the signaling cascade .

What phenotypes are observed in Wntless mutants?

Wntless mutations produce phenotypes that closely resemble those observed in Wnt signaling deficiencies. In Drosophila, loss of Wntless function disrupts Wingless-dependent patterning processes during development . One specific example involves follicle stem cell (FSC) proliferation in the Drosophila ovary. Studies using NRT-wg flies (containing membrane-tethered Wingless that cannot be secreted) demonstrate that hemizygous NRT-wg/null flies display dramatic reductions in fertility and FSC proliferation . When the wg locus was converted to NRT-wg only in adults, FSC proliferation was nearly undetectable, resulting in germarium phenotypes consistent with previously reported wg loss-of-function phenotypes . These findings indicate that Wntless-mediated Wnt secretion and subsequent protein spreading are essential for normal developmental processes. The phenotypic similarities between Wntless mutants and Wnt signaling defects further confirm Wntless's specific role in the Wnt pathway.

How conserved is Wntless across species?

Wntless demonstrates remarkable evolutionary conservation across diverse animal species, highlighting its fundamental importance in Wnt signaling. Research has confirmed the presence and functional activity of Wntless homologs in Drosophila melanogaster, Caenorhabditis elegans (where it mediates MOM-2-governed polarization of blastomeres), and humans (facilitating Wnt3a-mediated communication between cultured cells) . This conservation extends to both structural features and functional mechanisms. In each organism studied, Wntless acts specifically in Wnt-sending cells to promote the secretion of Wnt proteins . The high degree of conservation suggests that Wntless evolved early in animal evolution and has remained essential for proper development and tissue homeostasis. This evolutionary persistence underscores the critical nature of regulated Wnt secretion across metazoan lineages.

What mechanisms regulate Wntless trafficking within cells?

Wntless trafficking involves a complex series of intracellular events that ensure proper Wnt secretion. After facilitating Wnt transport to the cell membrane for release, Wntless undergoes endocytosis and recycling back to the Golgi apparatus for further rounds of Wnt protein transport . This recycling process is critical for maintaining efficient Wnt secretion, as disruptions in Wntless trafficking significantly impact Wnt signaling strength. Recent research has revealed "multiple layers of regulation along [the] secretory pathway" for Wnt proteins, with Wntless serving as a central regulatory component . The trafficking machinery involves elements of the endosomal sorting complex, retromer components, and specific adaptor proteins that recognize sorting signals within the Wntless protein sequence. Understanding these trafficking mechanisms is essential for comprehending how cells modulate Wnt secretion in response to developmental cues or tissue homeostasis requirements.

How do lipid modifications of Wnt proteins affect their interaction with Wntless?

Wnt proteins undergo critical lipid modifications that significantly influence their interaction with Wntless. The covalent attachment of palmitoleic acid to Wnt proteins complicates their secretion, as these lipid modifications render Wnts insoluble without proper chaperones . The crystal structure of Xenopus Wnt8 complexed with the extracellular domain of its receptor Frizzled8 revealed that the palmitate lipid moiety is completely buried in a hydrophobic cleft of the Frizzled cysteine-rich domain (CRD) . This interaction shields the palmitate group (attached at S239 in Wingless, S209 in Wnt3a) during receptor binding . Wntless likely performs a similar shielding function during intracellular transport, protecting the hydrophobic lipid modifications while ensuring proper folding and trafficking. Without Wntless, lipid-modified Wnt proteins would aggregate within the secretory pathway, preventing their release. This lipid-accommodating capability makes Wntless uniquely suited for its specialized chaperone function.

What is the relationship between Wntless and other Wnt pathway proteins like Porcupine?

Wntless functions within a coordinated network of proteins that collectively regulate Wnt processing and secretion. Porcupine, an O-acyltransferase, catalyzes the lipid modification of Wnt proteins within the endoplasmic reticulum . This lipid modification is essential for Wnt activity but creates challenges for the hydrophilic environment of the secretory pathway. Wntless subsequently acts as a dedicated chaperone that recognizes and binds these lipid-modified Wnt proteins, facilitating their movement through the secretory pathway to the plasma membrane . The sequential nature of these processes creates a dependency relationship - Wntless function depends on proper Porcupine-mediated Wnt lipidation, while Porcupine function would be ineffective without subsequent Wntless-mediated transport. This relationship illustrates how the Wnt secretion machinery has evolved specialized components to address the unique challenges of transporting lipid-modified signaling proteins. Research continues to uncover additional pathway components and their precise interactions.

How does Wntless contribute to long-range Wnt signaling gradients?

Wntless plays a crucial role in establishing Wnt concentration gradients that pattern tissues during development. These gradients depend on both the initial secretion of Wnt proteins and their subsequent movement through tissues. In Drosophila wing imaginal discs, Wingless moves dozens of cell diameters away from its source . Similarly, in the Drosophila ovary, Wingless spreads approximately 50 μm (about 5 cell diameters) from cap cells to follicle stem cells (FSCs) to stimulate FSC proliferation . Experiments with membrane-tethered NRT-Wg demonstrated that restricting Wingless movement dramatically reduces FSC proliferation, confirming that long-range Wnt signaling requires protein mobility . While Wntless primarily facilitates initial Wnt secretion, the quality and quantity of secreted Wnt directly impacts gradient formation. Additional extracellular factors including lipoprotein particles, reggie/flotillin proteins that promote lipid raft formation, and proteoglycans further modulate Wnt protein movement and stability once secreted .

What techniques have been most effective for studying Wntless-Wnt interactions?

Several complementary techniques have proven valuable for investigating Wntless-Wnt interactions. Genetic approaches in Drosophila have been particularly informative, including screens for suppressors of wingless-caused phenotypes to identify essential pathway components . Cell culture systems, especially Drosophila S2 cells (which normally lack wingless responsiveness), have been used for complementation studies to identify missing components like receptors . Biochemical approaches including co-immunoprecipitation have helped establish direct physical interactions between Wntless and Wnt proteins. Recent crystallography studies combining Wnt proteins with their receptors have provided structural insights that inform our understanding of how Wntless might interact with Wnt during transport . Novel techniques like proximity labeling (BioID or APEX) can further map the Wntless interactome. The most comprehensive understanding comes from integrating these diverse approaches - combining genetic manipulation, cell biology techniques, biochemical analysis, and structural studies to build a complete picture of Wntless function.

What are effective approaches for expressing recombinant Drosophila Wntless protein?

Expressing recombinant Drosophila Wntless presents several technical challenges due to its multi-transmembrane domain structure. For successful expression, consider the following methodological approaches: (1) Expression system selection - insect cell lines like Sf9 or S2 cells provide the most appropriate post-translational processing machinery for Drosophila proteins . (2) Vector design - include a strong promoter (like polyhedrin for baculovirus systems or metallothionein for inducible expression in S2 cells) and appropriate purification tags (C-terminal tags are often preferable as they're less likely to interfere with the N-terminal signal sequence). (3) Codon optimization - adjust codon usage to match the expression system while maintaining critical motifs. (4) Membrane protein solubilization - incorporate stabilizing mutations or expression as fusion proteins with soluble partners. (5) Expression conditions - optimize temperature, induction timing, and expression duration to balance quantity with proper folding. Pilot experiments comparing different constructs and conditions are essential for identifying optimal parameters for your specific experimental needs.

What purification strategies work best for recombinant Wntless protein?

Purifying recombinant Wntless requires specialized approaches for membrane proteins. An effective purification strategy involves: (1) Optimal cell lysis - use gentle detergents like DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) that maintain membrane protein structure while solubilizing from lipid bilayers. (2) Affinity chromatography - leverage affinity tags (His6, FLAG, or Strep-tag II) for initial capture, using detergent-containing buffers throughout. (3) Size exclusion chromatography - separate properly folded Wntless from aggregates and contaminants while maintaining detergent concentration above critical micelle concentration. (4) Consider alternative approaches - nanodiscs or styrene maleic acid lipid particles (SMALPs) can maintain native-like lipid environments. (5) Quality control - assess protein homogeneity via SDS-PAGE, Western blotting, and dynamic light scattering. (6) Functional validation - verify proper folding through limited binding assays with Wnt proteins. Each purification step should be optimized to minimize protein loss while maximizing purity, with conditions determined empirically for your specific construct.

How can I design effective genetic screens to identify Wntless interactors in Drosophila?

Designing genetic screens to identify Wntless interactors requires careful consideration of phenotypic readouts and screening strategies. Follow these methodological approaches: (1) Select an appropriate phenotype - use a Wntless-dependent developmental process with a clear, scorable phenotype such as wing disc patterning or follicle stem cell proliferation . (2) Generate sensitized backgrounds - create flies with partial loss or gain of Wntless function that produce intermediate phenotypes sensitive to enhancement or suppression. (3) Implement modifier screens - use EMS mutagenesis or defined deficiency lines to identify genes that modify your sensitized phenotype, similar to approaches used for wingless pathway components . (4) Design F1 screens for efficiency - create genetic backgrounds where modifiers can be detected in the first generation, as demonstrated with the pSEW-wingless phenotype screen . (5) Employ tissue-specific manipulation - use the GAL4-UAS system with tissue-specific drivers to examine effects in specific developmental contexts. (6) Establish secondary validation - confirm hits through independent alleles, RNAi, or biochemical approaches to eliminate false positives.

What assays can effectively measure Wntless-mediated Wnt secretion?

Several complementary assays can quantify Wntless-mediated Wnt secretion with varying degrees of sensitivity and specificity: (1) Cell culture secretion assays - express tagged Wnt proteins in cells with manipulated Wntless levels, then measure secreted Wnt in culture medium via Western blot or ELISA . (2) Wnt reporter systems - co-culture Wnt-producing cells with reporter cells containing Wnt-responsive elements driving luciferase or fluorescent protein expression; this measures functional Wnt secretion and signaling capacity . (3) Immunofluorescence approaches - visualize intracellular accumulation of Wnt proteins when Wntless function is compromised, using confocal microscopy to assess subcellular localization changes. (4) In vivo gradient formation - examine Wnt protein distribution in tissues using immunohistochemistry with quantitative image analysis to measure diffusion distances . (5) Biochemical fractionation - separate cellular compartments to track Wnt progression through the secretory pathway in the presence or absence of functional Wntless. (6) CRISPR-based screens - create cell libraries with Wntless mutations to identify domains critical for secretion function. These methodologies can be combined to provide comprehensive analysis of Wntless activity.

What are the most informative Drosophila models for studying Wntless function?

Several Drosophila models provide valuable insights into Wntless function across different developmental contexts: (1) Conditional expression systems - temperature-sensitive or drug-inducible Wntless alleles allow temporal control of protein function, separating developmental from homeostatic requirements . (2) Tissue-specific knockdowns - UAS-RNAi lines against Wntless, combined with tissue-specific GAL4 drivers, enable examination of tissue-specific requirements while avoiding systemic lethality. (3) MARCM clonal analysis - generate Wntless mutant clones in otherwise wild-type backgrounds to study cell-autonomous requirements and non-autonomous effects on neighboring cells . (4) NRT-wg models - membrane-tethered Wingless flies provide a powerful system to distinguish between secreted and membrane-bound Wnt signaling modes, revealing the importance of Wntless-mediated secretion for long-range signaling . (5) Protein domain mutants - systematic mutagenesis of Wntless domains helps map regions required for Wnt binding, trafficking, or recycling. (6) Reporter lines - combine Wntless manipulations with pathway reporters (e.g., armadillo/β-catenin levels) to directly measure signaling output . These models collectively provide a multifaceted view of Wntless function across developmental stages and tissues.

How can contradictory data regarding Wntless function be reconciled?

Resolving contradictory data about Wntless function requires systematic analysis and consideration of experimental context: (1) Distinguish tissue-specific effects - Wntless may function differently across developmental contexts; apparent contradictions may reflect genuine biological differences between tissues. (2) Consider dosage sensitivity - the wingless pathway shows dosage-dependent effects, where partial reduction can yield different phenotypes than complete loss . (3) Examine genetic background effects - modifiers present in different laboratory strains can significantly alter phenotypic outcomes of Wntless manipulation. (4) Evaluate methodological differences - contradictory results may stem from differences in protein detection methods, genetic tools, or assay sensitivities. (5) Perform epistasis experiments - place contradictory observations in pathway context by determining if Wntless acts upstream or downstream of other components in each experimental system. (6) Consider redundancy mechanisms - alternative secretion pathways may compensate for Wntless loss in some contexts but not others. (7) Develop quantitative models - mathematical modeling of contradictory datasets can sometimes reveal parameter regimes where apparently conflicting observations are actually compatible.

What considerations are important when interpreting phenotypes in Wntless-deficient systems?

Interpreting phenotypes in Wntless-deficient systems requires careful consideration of several factors: (1) Distinguish direct from indirect effects - primary phenotypes directly linked to Wnt secretion defects versus secondary consequences of disrupted development. (2) Consider perdurance - protein or mRNA persistence may mask immediate effects of genetic manipulation, necessitating careful temporal analysis. (3) Evaluate pathway specificity - confirm that observed phenotypes result from Wnt pathway disruption rather than effects on other signaling systems . (4) Quantify phenotypic severity - establish quantitative metrics to compare partial versus complete loss-of-function. For example, studies measuring follicle stem cell proliferation in Wntless-compromised ovaries demonstrated quantifiable differences between heterozygous and homozygous conditions . (5) Perform rescue experiments - test if phenotypes can be rescued by Wntless re-expression or by activating downstream pathway components. (6) Consider cellular context - evaluate how loss of Wntless affects both Wnt-producing and Wnt-receiving cells. (7) Examine allelic series - compare different Wntless alleles or knockdown efficiencies to establish dose-response relationships between Wntless activity and phenotypic outcomes.

How should structural predictions of Wntless be validated experimentally?

Validating structural predictions of Wntless requires multi-faceted experimental approaches: (1) Site-directed mutagenesis - systematically alter predicted structural elements (transmembrane domains, binding pockets) and assess functional consequences on Wnt binding and secretion. (2) Epitope mapping - use antibodies against specific domains to verify topology predictions through techniques like selective permeabilization immunofluorescence. (3) Protein fragmentation - express individual domains to test their specific functions or interactions. (4) Cysteine accessibility methods - introduce cysteines at strategic positions and test their accessibility to membrane-impermeable reagents to confirm transmembrane topology. (5) Fusion protein approaches - attach reporter proteins to different termini or loops to verify cellular localization and membrane orientation. (6) Crosslinking studies - use proximity-based crosslinking to identify regions that interact with Wnt proteins during transport. (7) Comparative analysis - leverage evolutionary conservation patterns across species to identify functionally essential structural elements . Current structural predictions suggest Wntless contains seven or eight transmembrane segments similar to GPCRs , but detailed experimental validation is necessary to confirm this arrangement and identify functional domains.

How can researchers effectively compare Wntless function across different model organisms?

Comparing Wntless function across model organisms requires methodological approaches that account for evolutionary and experimental differences: (1) Identify true orthologs - conduct phylogenetic analysis to establish genuine orthologous relationships rather than paralogs with potentially divergent functions. (2) Perform cross-species rescue experiments - test if Wntless from one species can rescue mutants in another to assess functional conservation. (3) Compare cellular contexts - examine Wntless in equivalent developmental contexts across species, such as comparing neural development in different models. (4) Standardize assay conditions - develop equivalent secretion assays using conserved Wnt proteins to directly compare Wntless efficiency. (5) Map functional domains - create chimeric proteins combining domains from different species to identify regions responsible for species-specific functions. (6) Consider expression patterns - compare spatiotemporal expression patterns of Wntless across species to identify conserved regulatory logic. Previous research has demonstrated functional conservation of Wntless across Drosophila, C. elegans, and human cells , providing a foundation for more detailed comparative studies.

What bioinformatic approaches are most useful for analyzing Wntless sequence and function?

Multiple bioinformatic approaches provide valuable insights into Wntless structure and function: (1) Transmembrane topology prediction - algorithms like TMHMM, Phobius, or TOPCONS can predict membrane-spanning regions and protein orientation, supporting the GPCR-like structure of Wntless . (2) Evolutionary analysis - phylogenetic methods and selection pressure analysis identify conserved domains under purifying selection, highlighting functionally critical regions. (3) Protein-protein interaction prediction - algorithms that identify potential binding motifs can suggest regions important for Wnt interaction or adaptor protein binding during trafficking. (4) Post-translational modification site prediction - identifying potential phosphorylation, glycosylation, or ubiquitination sites that might regulate Wntless activity or trafficking. (5) Structural modeling - homology modeling based on related proteins with solved structures, though more challenging for multi-pass membrane proteins. (6) Transcriptomic analysis - mining expression datasets across tissues and developmental stages to identify co-expression patterns with Wnt pathway components. (7) Variant analysis - examining natural variation in Wntless across populations to identify polymorphisms that might affect function. These computational approaches generate testable hypotheses about Wntless function that can guide experimental design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.