Recombinant Drosophila melanogaster Putative chemosensory receptor 43b (Gr43b)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Drosophila melanogaster Putative Chemosensory Receptor 43b (Gr43b) is a transmembrane protein expressed in E. coli and purified for research applications. Originally classified as a gustatory receptor (Gr) based on sequence homology , Gr43b is now recognized as a member of the Gr-like (Grl) family due to structural and evolutionary divergence from canonical chemosensory receptors . This protein is implicated in chemosensation, though its exact ligands and physiological roles remain under investigation.

Sequence Features

The protein sequence (MSTGSHSPEAM...GNISECVTHK) includes seven predicted transmembrane domains, consistent with its classification as a G protein-coupled receptor (GPCR) . Structural homology modeling suggests it belongs to the 7-transmembrane ion channel (7TMIC) superfamily, akin to insect odorant receptors .

Expression and Localization

  • Tissue Expression: Bulk RNA-seq data from D. melanogaster indicate very low expression (<1 FPKM) in most tissues, with sparse detection in neuronal clusters .

  • Cellular Role: Gr43b is hypothesized to function in aversive chemosensation, alongside Grl36a and Grl62c, based on co-expression in Gr66a-expressing bitter-sensing neurons .

Evolutionary Context

  • Gr43b clusters within the Grl lineage, which diverged early from canonical Grs .

  • Phylogenetic analyses reveal no close homologs outside drosophilids, suggesting rapid evolutionary divergence .

Experimental Use Cases

  • Antibody Production: Used as an immunogen for antibody generation .

  • Binding Assays: Employed in ELISA and other ligand-binding studies due to its transmembrane properties .

Key Studies

  • Structural Screens: Identified as a candidate 7TMIC homolog through structural similarity to A. bakeri Orco (PDB 6C70-A) .

  • Gene Targeting: Although not directly studied, homologs like Or43b have been functionally characterized via gene knockout, revealing odor-specific behavioral deficits .

Unresolved Questions

  1. Ligand Specificity: No direct deorphanization studies have identified Gr43b’s activating or inhibitory ligands .

  2. Behavioral Role: Its contribution to D. melanogaster chemosensory behavior remains unvalidated .

  3. Structural Confirmation: High-resolution crystallography or cryo-EM data are lacking .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
CG1339; Uncharacterized protein CG1339
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-430
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG1339
Target Protein Sequence
MSTGSHSPEAMWSATNFRRHQRKPNQVLHRWFFKGSAWIIYAIACGLHFFKLHYNERTNQ VEESQYHRIWSKIVVVLKVILLASPYLQYFVLGLGIYIHITLVQDSKAQNFLMSLIVLGI VIGVLRRLLIFLHLKRDRRFLKHTVNEILHITSALEQKFGMEYKCDSTLLVVYLAKLWIL TVMLDSLWYKPYFLSSIFLYWVLLEYCFAGYFIYQLILLSWYHTIILFLQRFIEDHANRL DIELHYHRRLIPLFELHLRINNLHKHVRDNVSWLSTSVYLMIFTCIFNAELLIECSLFAG DELENKIYIITDGCLGPVCVPILYVLILGMCTDRFRDAEVQLQQLFVIVQGLYMRKVRPH LLIAMVLENEHTSLIIHQKLKPLENMIILDITCDREFVMDYIVTVILTALSLVQYTISTG GNISECVTHK
Uniprot No.

Target Background

Database Links
Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr21a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Drosophila melanogaster Gr43b and how does it function in the chemosensory system?

    Gr43b (Putative chemosensory receptor 43b) is a member of the gustatory receptor family in Drosophila melanogaster. While less extensively characterized than its paralog Gr43a, it is believed to function as a chemosensory receptor involved in taste perception. The protein consists of 430 amino acids and contains multiple transmembrane domains characteristic of chemosensory receptors . Unlike Gr43a, which is a well-documented fructose sensor, the specific ligands for Gr43b remain less defined. Research suggests that Gr43b may be part of the broader chemosensory detection system that enables flies to detect and respond to various chemical cues in their environment .

  • How is Gr43b structurally and functionally related to other Drosophila gustatory receptors?

    Gr43b belongs to the larger family of gustatory receptors (Grs) in Drosophila, which consists of approximately 60 members encoded by 68 genes. Structurally, Gr43b shares the characteristic 7-transmembrane topology of gustatory receptors, though with inverted membrane topology compared to classic G protein-coupled receptors. Phylogenetically, Gr43b is most closely related to Gr43a, which functions as a fructose receptor . While Gr43a is expressed in multiple tissues including the brain, proventricular ganglion, and taste neurons, Gr43b shows a more restricted expression pattern. Recent structural studies have identified potential homology between insect chemoreceptors like Gr43b and certain mammalian proteins, suggesting evolutionary conservation of these sensory mechanisms across diverse animal phyla .

  • What expression patterns have been observed for Gr43b in Drosophila tissues?

    Gr43b shows a more restricted expression pattern compared to its paralog Gr43a. While Gr43a is expressed in taste neurons, brain, proventricular ganglion, and uterus, Gr43b expression appears to be more limited. Transcriptomic analyses have detected Gr43b expression primarily in a subset of gustatory sensilla. Unlike Gr43a, which is prominently expressed in a cluster of 6-8 neurons in the posterior superior lateral protocerebrum of the brain, Gr43b has not been consistently detected in these regions. Single-cell RNA sequencing data from the Fly Cell Atlas has helped refine our understanding of Gr43b expression, though its levels are generally lower than those of Gr43a across most tissues .

Research Applications

  • How can Gr43b research contribute to broader understanding of sensory system evolution?

    Gr43b research offers several insights into sensory system evolution:

    1. Evolutionary conservation: Comparative analysis of Gr43b with its orthologs in other insect species provides insights into evolutionary conservation of chemosensory mechanisms. For example, comparing Drosophila Gr43b with its ortholog in Bombyx mori (BmGr-9) reveals functional similarities despite sequence divergence .

    2. Receptor-ligand co-evolution: Identifying Gr43b ligands can illuminate how receptor specificity evolves in response to environmental and dietary changes across species.

    3. Adaptive variation: Mapping natural variation in Gr43b sequence and function across Drosophila populations from different environments can reveal signatures of adaptive evolution .

    4. Comparative neurobiology: Understanding how Gr43b-expressing neurons are integrated into neural circuits provides insights into the evolution of sensory processing networks.

    5. Structural evolution: Recent structural screens identifying potential homology between insect chemoreceptors and mammalian proteins suggest either deep evolutionary relationships or convergent evolution of similar structures for chemosensation .

    These evolutionary insights extend beyond Drosophila and contribute to our general understanding of how sensory systems evolve across animal phyla.

  • What experimental paradigms are most effective for studying Gr43b's role in Drosophila behavior?

    Several experimental paradigms can effectively probe Gr43b's behavioral roles:

    1. Two-choice feeding assays: These can test preference or aversion to potential Gr43b ligands, comparing wild-type and Gr43b mutant flies.

    2. CAFÉ assay (Capillary Feeder): This quantitative assay measures consumption of liquid food from capillaries and can detect subtle differences in feeding behavior.

    3. PER (Proboscis Extension Reflex): This assay evaluates gustatory responses by measuring proboscis extension to tastants applied to tarsal chemosensilla.

    4. Optogenetic activation/silencing: Using Gr43b-GAL4 to express channelrhodopsin or inhibitory tools in Gr43b neurons allows for temporal control of neural activity during behavioral assays.

    5. Conditional silencing: Temperature-sensitive tools like shibirets can be used to conditionally inactivate Gr43b neurons at specific developmental stages or during specific behaviors.

    6. Tracking systems: Automated tracking of freely moving flies can detect subtle behavioral changes in response to chemosensory cues that might activate Gr43b.

    7. Integration with physiological measures: Combining behavioral assays with measurements of physiological parameters (e.g., insulin signaling, metabolism) can reveal broader systemic roles of Gr43b signaling .

  • How can researchers effectively distinguish the functions of Gr43b from those of related receptors like Gr43a?

    Distinguishing the functions of Gr43b from related receptors requires:

    1. Receptor-specific genetic tools: Generate clean knockouts specific to Gr43b without affecting Gr43a or other nearby genes. CRISPR-Cas9 is ideal for this purpose.

    2. Double mutant analysis: Create and characterize Gr43a/Gr43b double mutants to identify redundant and unique functions.

    3. Rescue experiments: Perform specific rescue of each receptor in corresponding mutant backgrounds to determine which phenotypes are associated with which receptor.

    4. Heterologous expression: Express each receptor individually in "empty neuron" systems to determine ligand specificity profiles .

    5. Receptor chimeras: Create chimeric receptors with domains from both Gr43a and Gr43b to identify regions responsible for specific functional properties.

    6. Spatiotemporal expression mapping: Use receptor-specific reporters (e.g., Gr43b-GAL4 and Gr43a-GAL4) to precisely map expression patterns and identify regions of overlap and distinction.

    7. Single-cell transcriptomics: Analyze the complete transcriptional profile of Gr43a vs. Gr43b-expressing cells to identify unique cellular contexts.

    These approaches, used in combination, can effectively dissect the specific contributions of Gr43b versus related receptors.

  • What are the most promising future directions for Gr43b research in neurobiology and sensory biology?

    Several promising directions for future Gr43b research include:

    1. Deorphanization: Identifying the specific ligands that activate Gr43b remains a critical goal. High-throughput screening approaches combining heterologous expression with calcium imaging or electrophysiology can systematically test candidate ligands.

    2. Circuit mapping: Detailed mapping of the neural circuits downstream of Gr43b-expressing neurons will illuminate how chemosensory information is processed and integrated with other sensory modalities.

    3. Neuromodulation: Investigating whether Gr43b neurons release neuromodulators (similar to how Gr43a neurons in the brain co-express Corazonin ) that affect broader physiological functions.

    4. Metabolic integration: Exploring potential roles of Gr43b in nutrient sensing and metabolic regulation, similar to the role of Gr43a in sensing hemolymph fructose levels .

    5. Translational applications: Using insights from Gr43b research to inform development of novel insect control strategies targeting chemosensory systems.

    6. Comparative approaches: Expanding studies to Gr43b orthologs in disease vectors like mosquitoes could yield valuable insights for vector control.

    7. Structural biology: Determining the three-dimensional structure of Gr43b would significantly advance understanding of insect chemoreceptor function and could inform structure-based design of modulators.

    These directions will not only enhance our understanding of insect chemosensation but may also yield insights applicable to sensory biology across species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.