Recombinant Drosophila melanogaster Putative fatty acyl-CoA reductase CG5065 (CG5065)

Shipped with Ice Packs
In Stock

Description

Functional Context within the FAR Family

Fatty acyl-CoA reductases catalyze the reduction of acyl-CoA to alcohols and aldehydes, representing a critical step in various biosynthetic pathways . In Drosophila, FARs are involved in both core fatty acid biosynthesis and the production of cuticular hydrocarbons (CHCs) . CHCs form a waxy layer on the insect cuticle that prevents desiccation and serves as pheromones for chemical communication, making them essential for both survival and reproduction in flies.

While direct experimental evidence for CG5065's specific function is limited in the available literature, its classification as a putative fatty acyl-CoA reductase suggests potential involvement in these pathways. The broader FAR gene family in Drosophila has been extensively studied, with researchers identifying approximately 200 FAR proteins across 12 Drosophila species . This diversity reflects the importance and evolutionary plasticity of this gene family.

Table 2: Potential Functions of CG5065 Based on FAR Family Characteristics

FunctionEvidenceConfidence Level
Fatty acid metabolismSequence homology to known FARsHigh
Cuticular hydrocarbon biosynthesisRelationship to FAR familyModerate
Alcohol/aldehyde production from acyl-CoAEC classificationHigh
Peroxisomal metabolismAssociation with fatty acid oxidation pathwaysLow-Moderate

Evolutionary Context of CG5065

The FAR gene family in Drosophila exhibits a birth-and-death evolutionary pattern, characterized by gene duplications, subsequent gene losses, and alternative splicing . This evolutionary pattern has generated considerable diversity in FAR gene content across Drosophila species, reflecting rapid adaptation to varying environmental conditions and mate recognition systems.

Studies on the FAR family reveal that different members show varying evolutionary stability. FARs involved in core metabolic functions tend to be more conserved across species, while those involved in rapidly evolving traits like CHC biosynthesis typically show greater instability . The evolutionary stability of CG5065 specifically is not explicitly documented in the provided search results, which presents an opportunity for future research to determine whether it belongs to the stable or unstable class of FAR genes.

Tissue Expression and Functional Implications

The site of expression provides important clues about a protein's function. In Drosophila, the biosynthesis of fatty acyl-CoA occurs in various tissues, but CHC biosynthesis specifically takes place in specialized cells called oenocytes . Research has identified several FARs expressed in oenocytes, including CG13091, CG10097, CG17560, and CG4020 . The expression pattern of CG5065 is not explicitly mentioned in the provided search results, highlighting another area for future investigation.

Recombinant CG5065 Production and Applications

Recombinant proteins serve as valuable tools for biochemical characterization, functional studies, and antibody production. The commercial availability of recombinant Drosophila melanogaster putative fatty acyl-CoA reductase CG5065 facilitates such research endeavors . Typically, recombinant proteins are produced by cloning the gene of interest into an expression vector, transforming it into a suitable host (often bacteria or yeast), inducing expression, and subsequently purifying the target protein.

The recombinant CG5065 protein is available in quantities of 50 μg, stored in a Tris-based buffer with 50% glycerol optimized for stability . For extended storage, the protein should be kept at -20°C or -80°C, with working aliquots maintained at 4°C for up to one week . Repeated freezing and thawing is not recommended, as this can compromise protein integrity.

Research Applications

Recombinant CG5065 can be utilized in various research applications, including:

  1. Enzymatic assays to characterize substrate specificity and kinetic parameters

  2. Structural studies to elucidate protein folding and catalytic mechanisms

  3. Interaction studies to identify binding partners and regulatory factors

  4. Generation of antibodies for localization and expression studies

  5. Functional complementation assays in mutant backgrounds

CG5065 in the Context of Peroxisomal Metabolism

Peroxisomes are ubiquitous organelles housing essential biochemical pathways, including the breakdown of fatty acids by β-oxidation . Drosophila melanogaster possesses the enzymes required for this process, making it a valuable model system for studying peroxisomal metabolism. While the specific subcellular localization of CG5065 is not explicitly stated in the provided search results, many enzymes involved in fatty acid metabolism are associated with peroxisomes.

The peroxisomal proteome in Drosophila includes various proteins involved in lipid metabolism . Understanding whether CG5065 functions within peroxisomes would provide important insights into its role in cellular metabolism and potential involvement in peroxisomal disorders.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request as much as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CG5065; Putative fatty acyl-CoA reductase CG5065
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-625
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG5065
Target Protein Sequence
MSHAVANKTETEAAPNSSLKQSAAPQPANSHDAKLLNGTLARTNGLTHAASVATSSSGSY GSSSAAGSNAGSGGPTSSASLSIAAGVASSTALPLPPSSNGLQMPYERFRADDTSYVPIA QFYAGRSVFITGGTGFMGKVLVEKLLRSCPEIRNIYLLIRPKRGQEVSARLTELLNAPLF ESLRQEKPKELSKVIPISGDITSEELGISEKDQNLLCRNVSVVFHSAATVKFDEKLKLSV TINMLGTKRLVELCHRMLSLDALIHVSTAYCNCDRTDVSEVIYAPPYNPDDIISLINWLP EDILDQLTPRLIGKRPNTYTFTKALAEHMLLKEAGNLPVAIVRPSIVTASLNEPFAGWVD NFNGPTGLVSALAKGMFRTMMCEKNYVADMVPVDIVINLMIAAAWRTATRKSNNLLIYNC CTGQRNPIIWSEFVKHAMTSVRKHPLEGCLWYPTGDLRMNRPMNTLNCIAKHFLPAYILD GVARIMGKKPFVVNVQNKIAKAVECLEYFATRQWRFKDDNVHALLHTLSPKDREIFVFDV RHINWDKYVERYVLGFREFLFKQRPESLPASRKRMLRLYYLHQLTKLVAVLLTWRFLMSR SKRLNDLWSSFLENALRMARLIPFL
Uniprot No.

Target Background

Function
This enzyme catalyzes the reduction of C16 or C18 fatty acyl-CoA to fatty alcohols.
Database Links

KEGG: dme:Dmel_CG5065

STRING: 7227.FBpp0086254

UniGene: Dm.18612

Protein Families
Fatty acyl-CoA reductase family
Subcellular Location
Peroxisome membrane; Single-pass membrane protein.

Q&A

What is the biochemical function of CG5065 in Drosophila melanogaster?

CG5065 functions as a putative fatty acyl-CoA reductase in Drosophila melanogaster, catalyzing the reduction of fatty acyl-CoA substrates to fatty alcohols. This enzyme belongs to the larger fatty acyl-CoA reductase (FAR) family, which plays crucial roles in lipid metabolism pathways. As part of a diverse gene family, CG5065 contributes to the complex network of lipid metabolism in Drosophila, potentially affecting processes ranging from energy homeostasis to cuticular hydrocarbon synthesis .

How is CG5065 related to other fatty acyl-CoA reductases in Drosophila?

CG5065 is one member of a diverse FAR protein family in Drosophila species. Phylogenetic analyses have revealed that Drosophila genomes contain between 14 to 21 FAR genes, which split into 18 main clades through evolutionary diversification. These FARs have evolved through birth-and-death evolution, creating the functional diversity observed across species. CG5065 represents one of these evolutionary lineages within the larger FAR family structure .

What expression patterns does CG5065 show during Drosophila development?

CG5065 expression varies across developmental stages, with particularly notable expression in the fat body. Gene expression analyses have demonstrated that developmental stage accounts for approximately 75% of the variation in expression profiles, while population differences account for about 10% of the remaining variation. This suggests that CG5065's expression is highly regulated during development, particularly during the transition from larval to pupal stages when lipid metabolism undergoes significant changes .

What recombinant expression systems are optimal for producing functional CG5065?

For recombinant expression of CG5065, Escherichia coli-based expression systems have been successfully employed. The protein can be expressed in vitro using E. coli expression systems with appropriate vector selection. For optimal expression, the CG5065 ORF (1734bp in D. biarmipes, 1497bp in D. busckii) can be cloned into expression vectors such as pcDNA3.1+/C-(K)DYK using seamless cloning technology (e.g., CloneEZ™). The recombinant protein may be tagged (commonly with C-terminal DYKDDDDK tags) to facilitate purification and detection .

What purification strategies yield the highest activity for recombinant CG5065?

The optimal purification strategy involves:

  • Expression in E. coli with appropriate induction conditions

  • Cell lysis under conditions that preserve enzymatic activity

  • Initial capture using affinity chromatography (leveraging C-terminal tags)

  • Further purification via size exclusion or ion exchange chromatography

  • Activity verification using a fatty acyl-CoA reductase assay

To maintain enzymatic activity, purification buffers should contain:

Buffer ComponentConcentrationPurpose
HEPES or Tris50 mM (pH 7.5)pH stabilization
NaCl150-300 mMIonic strength
Glycerol10-15%Protein stability
DTT or β-mercaptoethanol1-5 mMMaintain reduced cysteines
Protease inhibitorsAs recommendedPrevent degradation

The purified enzyme should be stored at -80°C in small aliquots to prevent repeated freeze-thaw cycles that can compromise activity .

How can researchers effectively measure CG5065 enzymatic activity in vitro?

CG5065 enzymatic activity can be measured using a coupled spectrophotometric assay that monitors the oxidation of NADPH to NADP+ during the reduction of fatty acyl-CoA to fatty alcohols. A standard assay mixture includes:

ComponentConcentrationFunction
Purified CG50650.1-1 μgEnzyme
Fatty acyl-CoA substrate50-100 μMSubstrate
NADPH200 μMElectron donor
Phosphate buffer100 mM (pH 7.0)Reaction medium
MgCl₂5 mMCofactor

The decrease in absorbance at 340 nm (NADPH consumption) is monitored over time. Substrate specificity can be assessed by testing various fatty acyl-CoA chain lengths (C8-C24). Activity should be normalized to protein concentration, and kinetic parameters (Km, Vmax) determined through Michaelis-Menten analysis of initial reaction rates at varying substrate concentrations.

How does CG5065 vary across different Drosophila species?

CG5065 shows significant sequence and functional variation across Drosophila species, reflecting evolutionary adaptations to different ecological niches. Comparative analysis of CG5065 across species reveals:

SpeciesCG5065 Ortholog LengthKey Sequence FeaturesNotable Adaptations
D. melanogasterFull-length sequenceReference geneStandard model
D. biarmipes1734bp ORFSpecies-specific variantsAdapted to tropical environments
D. busckii1497bp ORFTwo isoforms (X1, X2)Adaptations to diverse habitats

These variations suggest that CG5065 has undergone adaptive evolution in different Drosophila lineages, potentially reflecting differing requirements for lipid metabolism across species with different ecological adaptations .

What evolutionary patterns are observed in the FAR gene family containing CG5065?

The FAR gene family, including CG5065, shows a pattern of birth-and-death evolution across Drosophila species. This evolutionary process has generated a remarkable diversity in FAR content, with the number of FAR genes ranging from 14 to 21 across 12 sequenced Drosophila genomes. Phylogenetic reconstruction of 200 FAR proteins reveals 18 main clades, with some clades originating through lineage-specific gene duplications, particularly in the melanogaster group. After accounting for these lineage-specific duplications, it appears that the last common ancestor of extant Drosophila species possessed at least 15 FAR genes, indicating both gene gain and loss events throughout Drosophila evolution .

What role does CG5065 play in Drosophila lipid metabolism and cuticular hydrocarbon synthesis?

CG5065, as a fatty acyl-CoA reductase, likely contributes to cuticular hydrocarbon (CHC) biosynthesis in Drosophila. CHCs form a lipid layer on the insect cuticle that reduces water evaporation, providing desiccation resistance. Research across 50 Drosophila and related species has shown that variations in CHC composition, particularly in methyl-branched CHCs (mbCHCs), correlate strongly with desiccation resistance. As a fatty acyl-CoA reductase, CG5065 likely participates in the reduction step of the CHC biosynthetic pathway, converting fatty acyl-CoAs to fatty alcohols, which are precursors for subsequent steps in CHC synthesis .

How does CG5065 expression relate to fat body function during Drosophila development?

CG5065 expression in the fat body is developmentally regulated, showing distinct patterns during the early and late wandering larval stages and the prepupal stage. These expression patterns appear to contribute to the metabolic reprogramming that occurs during metamorphosis. In comparative studies between European (Dutch) and African (Zambian) populations, significant differences in gene expression were observed in the fat body during development. Such expression differences in metabolic genes like CG5065 may contribute to phenotypic differences between populations, such as body weight variation. The temporal dynamics of CG5065 expression likely reflect its changing roles in lipid metabolism throughout development .

What are the most effective RNAi approaches for studying CG5065 function in vivo?

For effective CG5065 knockdown in Drosophila, a tissue-specific GAL4/UAS-RNAi approach is recommended:

  • Driver selection: For lipid metabolism studies, target expression to tissues where CG5065 functions:

    • Fat body-specific drivers (e.g., Lsp2-GAL4, cg-GAL4)

    • Oenocyte-specific drivers (e.g., 5′ mFAS-GAL4)

  • RNAi construct design: Minimize off-target effects with:

    • 21-23 nucleotide target sequences with minimal homology to other genes

    • Multiple non-overlapping constructs to confirm phenotypes

    • shRNA designs that efficiently enter the RNAi pathway

  • Validation methodology:

    • qRT-PCR to confirm mRNA reduction (>70% knockdown efficiency)

    • Western blot or immunostaining (if antibodies available)

    • Complementary CRISPR approaches to validate phenotypes

For oenocyte-specific studies, the 5′ mFAS-GAL4 driver can be constructed by cloning the oenocyte enhancer fragment of the mFAS/FASN2 (CG3524) gene into the GAL4 vector pBPGUw using specific primers (5′CG3524-TOPO-F: 5′-CACCCCGCGGCGTGTTATTGAACC-3′ and 5′CG3524-TOPO-R: 5′-CTTGTTGCGCAGACAGACTG-3′), followed by genome integration using the PhiC31 integrase system .

How can CRISPR-Cas9 be optimized for generating CG5065 mutants in Drosophila?

For generating precise CG5065 mutants in Drosophila using CRISPR-Cas9:

  • gRNA design considerations:

    • Target conserved catalytic domains for null mutations

    • Design multiple gRNAs (preferably 3-4) for each target region

    • Use tools like CHOPCHOP or CRISPOR for optimal gRNA selection

    • Ensure minimal off-target effects by careful sequence analysis

  • Repair template strategy:

    • For precise mutations: HDR templates with ~1kb homology arms

    • For reporter integration: include fluorescent markers with flexible linkers

    • For domain deletion: carefully define deletion boundaries to maintain reading frame

  • Screening protocol:

    • Initial screening via T7 endonuclease assay or HRMA

    • Confirmation by sequencing of target region

    • Functional validation via enzyme activity assays

  • Control considerations:

    • Generate revertants to confirm phenotype causality

    • Create catalytic-dead mutations for mechanistic studies

    • Include wild-type controls from the same genetic background

This approach enables precise genetic manipulation of CG5065 to study its function in various aspects of Drosophila biology.

What statistical approaches are most appropriate for analyzing phenotypic effects of CG5065 manipulation?

When analyzing phenotypic effects of CG5065 manipulation in Drosophila, the following statistical considerations are essential:

  • Sample size determination:

    • For somatic mutation tests in Drosophila, calculate optimal sample size in advance

    • Aim for equal numbers of flies in control and treated series for optimal statistical power

    • Consider potential overdispersion in data when planning experiments

  • Statistical test selection:

    • For normally distributed data: parametric tests (t-test, ANOVA)

    • For non-normally distributed data: non-parametric alternatives (U test)

    • For count data with potential overdispersion: adjust tests accordingly

    • For survival analyses (e.g., desiccation resistance): Kaplan-Meier with log-rank tests

  • Accounting for confounding variables:

    • Body size differences: use dry weight as a covariate

    • Genetic background effects: use appropriate genetic controls

    • Sex-specific effects: analyze males and females separately

    • Developmental timing: carefully stage-match experimental groups

  • Advanced analytical approaches:

    • For gene expression studies: DESeq2 for differential expression analysis

    • For complex phenotypes: multivariate analyses (PCA, WGCNA)

    • For population comparisons: consider evolutionary history and population structure

When designing desiccation resistance assays to study potential CG5065 effects on CHC composition, protocols should include 10 adults of the same sex per cohort, subjected to silica gel desiccation, with mortality recorded hourly and average time until death recorded as the measure of desiccation resistance .

How does CG5065 function relate to Sgroppino (Sgp) and fat metabolism in Drosophila?

CG5065 and Sgroppino (Sgp) are both members of the fatty acyl-CoA reductase family in Drosophila, with potentially overlapping yet distinct functions. Sgp (FlyBase gene CG13091) is characterized as an alcohol-forming fatty acyl-CoA reductase (EC 1.2.1.84) that links fat metabolism with survival after RNA virus infection. Named 'Sgroppino' because mutants exhibit a distinctive phenotype where a larger mass of fat body tissue remains attached to the abdominal carcass, forming large oleaginous droplets that appear white (reminiscent of the Sgroppino cocktail) .

The functional relationship between CG5065 and Sgp likely involves:

  • Shared enzymatic mechanisms in fatty acyl-CoA reduction

  • Potentially different substrate specificities or expression patterns

  • Distinct but complementary roles in lipid metabolism pathways

Understanding the relationship between these enzymes provides insight into the complex regulation of fat metabolism in Drosophila and its connection to immune responses and survival after viral infection .

How can gene expression differences in CG5065 between Drosophila populations inform evolutionary adaptation studies?

Gene expression differences in CG5065 between Drosophila populations offer valuable insights into evolutionary adaptation:

  • Population-specific expression patterns:

    • European (Dutch) and African (Zambian) D. melanogaster populations show distinct gene expression profiles in the fat body

    • These differences may reflect adaptations to different environmental conditions and selective pressures

  • Developmental stage-specificity:

    • Expression differences between populations vary across developmental stages

    • This temporal dimension of expression divergence reveals how adaptation occurs in stage-specific developmental programs

  • Phenotypic consequences:

    • Expression differences in lipid metabolism genes like CG5065 can contribute to phenotypic differences between populations

    • Body weight determination, a trait with adaptive significance, may be influenced by such expression differences

  • Evolutionary implications:

    • Expression divergence can precede coding sequence divergence in adaptation

    • Regulatory changes in genes like CG5065 may be a more flexible mechanism for rapid adaptation to new environments

This research approach connects molecular differences in gene expression to phenotypic variation and evolutionary adaptation, providing insight into how organisms adapt to diverse environments through changes in metabolic gene regulation .

What are common challenges in expressing and purifying functional recombinant CG5065?

Researchers frequently encounter several challenges when working with recombinant CG5065:

  • Protein solubility issues:

    • Challenge: CG5065 may form inclusion bodies during bacterial expression

    • Solution: Optimize expression conditions (lower temperature, reduced IPTG concentration)

    • Alternative: Use solubility enhancers like SUMO or MBP fusion tags

  • Enzymatic activity preservation:

    • Challenge: Loss of activity during purification

    • Solution: Include stabilizing agents (glycerol, reducing agents) in all buffers

    • Recommendation: Minimize purification steps and handling time

  • Substrate specificity determination:

    • Challenge: Identifying physiologically relevant substrates

    • Approach: Screen multiple chain-length fatty acyl-CoAs (C8-C24)

    • Method: Compare kinetic parameters across substrate panel

  • Cofactor requirements:

    • Challenge: Determining optimal cofactor concentrations

    • Solution: Titrate NADPH and potential metal ion cofactors

    • Consideration: Test both NADH and NADPH as potential electron donors

When troubleshooting expression issues, consider using vectors like pcDNA3.1+/C-(K)DYK with C-terminal DYKDDDDK tags and implementing seamless cloning technology for optimal results .

How can researchers effectively design experiments to distinguish the specific functions of CG5065 from other FARs in Drosophila?

To distinguish CG5065's specific functions from other fatty acyl-CoA reductases:

  • Precise genetic manipulation:

    • Create single and combinatorial mutants of different FAR genes

    • Use CRISPR-Cas9 for precise gene editing rather than RNAi alone

    • Generate conditional alleles for temporal control of gene inactivation

  • Biochemical characterization:

    • Determine substrate specificity profiles for each FAR

    • Compare kinetic parameters and inhibitor sensitivity

    • Identify unique post-translational modifications

  • Expression pattern analysis:

    • Create reporter constructs to visualize spatial-temporal expression

    • Perform single-cell RNA-seq of relevant tissues

    • Compare expression profiles across developmental stages

  • Functional complementation:

    • Test cross-species rescue with orthologs from other Drosophila species

    • Assess whether other FARs can rescue CG5065 mutant phenotypes

    • Create chimeric proteins to identify functionally distinct domains

  • Experimental design considerations:

    • Use appropriate genetic backgrounds to control for modifiers

    • Implement rigorous controls to account for genetic compensation

    • Design experiments to detect redundancy between FAR family members

This multifaceted approach allows researchers to distinguish the unique functions of CG5065 from the 14-21 other FAR family members present in Drosophila genomes .

What are promising approaches for investigating CG5065's role in desiccation resistance and adaptation to arid environments?

Future research into CG5065's role in desiccation resistance should consider:

  • Comparative genomics approach:

    • Compare CG5065 sequence and expression across Drosophila species from diverse habitats

    • Correlate CG5065 variants with desiccation resistance phenotypes

    • Identify signatures of selection in CG5065 in populations from arid environments

  • Functional validation experiments:

    • Generate CG5065 mutations in species with varying desiccation resistance

    • Perform tissue-specific knockdown in oenocytes, the CHC-producing cells

    • Conduct targeted overexpression to test for enhanced desiccation resistance

  • Mechanistic investigation:

    • Analyze CHC composition changes in CG5065 mutants

    • Focus particularly on methyl-branched CHCs (mbCHCs), key determinants of desiccation resistance

    • Measure water loss rates and survival under desiccation stress

  • Integrative approaches:

    • Combine genetic manipulation with metabolomic analysis

    • Link CHC compositional changes to desiccation resistance phenotypes

    • Use machine learning to identify patterns in CHC profiles that predict desiccation resistance

These approaches would build on findings that desiccation resistance differences across Drosophila species can be largely explained by variation in CHC composition, particularly in mbCHCs, potentially linking CG5065 activity to environmental adaptation .

How might CG5065 function integrate with other metabolic pathways during development and stress response?

CG5065's integration with broader metabolic networks presents several promising research directions:

  • Developmental metabolic reprogramming:

    • Investigate CG5065's role in the metabolic shifts during metamorphosis

    • Examine how developmental hormones regulate CG5065 expression

    • Explore connections between CG5065 and the insulin/TOR signaling pathways

  • Stress response integration:

    • Study how CG5065 activity changes under various stressors (thermal, oxidative, nutritional)

    • Determine whether CG5065 contributes to the synthesis of lipid-derived signaling molecules

    • Investigate potential roles in membrane remodeling during stress

  • Multi-omics approaches:

    • Combine transcriptomics, proteomics, and metabolomics in CG5065 mutants

    • Map the flow of metabolites through pathways affected by CG5065

    • Identify compensatory mechanisms activated in response to CG5065 disruption

  • Systems biology modeling:

    • Develop computational models of lipid metabolism incorporating CG5065

    • Simulate pathway dynamics under different developmental or environmental conditions

    • Predict emergent properties of the system under perturbation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.