Recombinant Drosophila melanogaster Putative fatty acyl-CoA reductase CG8303 (CG8303)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Drosophila melanogaster Putative Fatty Acyl-CoA Reductase CG8303 (CG8303) is a protein expressed in E. coli and tagged with N-terminal His for ease of purification and identification . CG8303 is involved in the synthesis of cuticular hydrocarbons (CHCs) . These hydrocarbons are crucial for insect communication and recognition . CG8303 catalyzes the reduction of fatty acyl-CoA to fatty alcohols .

Gene Information

Gene NameCG8303
SynonymsPutative fatty acyl-CoA reductase CG8303
SpeciesDrosophila melanogaster (Fruit fly)
UniProt IDA1ZAI3

Protein Details

AttributeDescription
SourceE. coli
TagHis-Tagged
Protein LengthFull Length (1-620 amino acids)
AA SequenceMPSLTPKSNYQNQQNISPQSVLSERASALAASWLKADPPQWPTYPSISLSPPTLLLAAPSSNLSSKLAPPTNLEPYTMAVITEHGGTTSSPPENNNSIGNGKHRVNGHQLSTSLTIPEFFAHKNIFVTGGTGFLGTVLIEALLDTHPDIGTIYVLVRGKRKFDPNERIRRLLQKPIFEKYSEKTLSKVVPVVGELSEPNFGFGPELLQELIDRVNVIYHSAATIKFSSPLRTAIRTNLTGTMRTIELAKQLKQLAAYIYCSTAFCNSNNRGLIAEEVYKSQFDPYEMMKMAEDDSAWEDFTDQKCKGYIRDHPNTYTFTKNLSENLLMAEMSGLPAAIVRPSIVYGTLEHPMKGWVGNANSGHLGFLAGFVKGIFRTMCGNANAVIDIIPCDYVINSSLVMGWYVGTRKLEQPEIIHCTSGEVNPLNLAEFCTIINDSVERHPPNSFVWKPVTKLRNGWRYNLFFYLFHLLPAMVFIIPEK LFGIGMPQHTAYEYMRVFQKGTKAFDYFLDKDFRYSLKNALRISALIPESDRRRYFDASQCDWSEFIDRCLIGIRRFYFKESAVTTDWHRNYWKVFNVLYYAGYVVIFAVLYFALTLTLGLQIGLTLAVLIWGFLVWL
PurityGreater than 90% as determined by SDS-PAGE
Molecular FunctionCatalyzes the reduction of fatty acyl-CoA to fatty alcohols
Expression Region1-620

Functional Insights

CG8303 is a member of the fatty acyl-CoA reductase (FAR) gene family . FARs catalyze the reduction of acyl-CoA to alcohols and aldehydes . CG8303 is associated with intraspecific CHC variation in D. melanogaster . The biosynthesis of fatty acyl-CoA occurs in many tissues in the fly, but the biosynthesis of CHCs specifically occurs in the oenocytes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
CG8303; Putative fatty acyl-CoA reductase CG8303
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-620
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG8303
Target Protein Sequence
MPSLTPKSNYQNQQNISPQSVLSERASALAASWLKADPPQWPTYPSISLSPPTLLLAAPS SNLSSKLAPPTNLEPYTMAVITEHGGTTSSPPENNNSIGNGKHRVNGHQLSTSLTIPEFF AHKNIFVTGGTGFLGTVLIEALLDTHPDIGTIYVLVRGKRKFDPNERIRRLLQKPIFEKY SEKTLSKVVPVVGELSEPNFGFGPELLQELIDRVNVIYHSAATIKFSSPLRTAIRTNLTG TMRTIELAKQLKQLAAYIYCSTAFCNSNNRGLIAEEVYKSQFDPYEMMKMAEDDSAWEDF TDQKCKGYIRDHPNTYTFTKNLSENLLMAEMSGLPAAIVRPSIVYGTLEHPMKGWVGNAN SGHLGFLAGFVKGIFRTMCGNANAVIDIIPCDYVINSSLVMGWYVGTRKLEQPEIIHCTS GEVNPLNLAEFCTIINDSVERHPPNSFVWKPVTKLRNGWRYNLFFYLFHLLPAMVFIIPE KLFGIGMPQHTAYEYMRVFQKGTKAFDYFLDKDFRYSLKNALRISALIPESDRRRYNFDA SQCDWSEFIDRCLIGIRRFYFKESAVTTDWHRNYWKVFNVLYYAGYVVIFAVLYFALTLT LGLQIGLTLAVLIWGFLVWL
Uniprot No.

Target Background

Function
This recombinant Drosophila melanogaster protein, Putative fatty acyl-CoA reductase CG8303 (CG8303), catalyzes the reduction of C16 or C18 fatty acyl-CoA to fatty alcohols.
Database Links
Protein Families
Fatty acyl-CoA reductase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is CG8303 and what is its function in Drosophila melanogaster?

CG8303 is a putative fatty acyl-CoA reductase in Drosophila melanogaster that consists of 620 amino acids . As a member of the fatty acyl-CoA reductase family, it likely catalyzes the reduction of fatty acyl-CoA substrates to fatty alcohols, playing a potential role in lipid metabolism pathways. The protein contains characteristic domains including an NAD(P)-binding domain and a reductase domain, which are essential for its enzymatic function. In Drosophila, fatty acyl-CoA reductases are involved in multiple biological processes including cuticular hydrocarbon biosynthesis, pheromone production, and membrane lipid homeostasis.

How is recombinant CG8303 typically produced for research applications?

Recombinant CG8303 protein is typically produced through heterologous expression in E. coli bacterial systems . The full-length protein (amino acids 1-620) is usually expressed with an N-terminal histidine tag to facilitate purification. The production process involves:

  • Cloning the CG8303 coding sequence into an appropriate expression vector

  • Transforming the recombinant vector into a compatible E. coli strain

  • Inducing protein expression under optimized conditions (temperature, time, inducer concentration)

  • Cell lysis to release the recombinant protein

  • Affinity chromatography purification using the His-tag

  • Quality control analysis including SDS-PAGE and Western blotting

  • Lyophilization for long-term storage and stability

What expression systems are suitable for CG8303 production besides E. coli?

While E. coli is commonly used for CG8303 expression , alternative expression systems may provide advantages for specific research applications:

Expression SystemAdvantagesLimitationsSuitable Applications
Insect cells (Sf9, S2)Native post-translational modifications, proper folding of Drosophila proteinsHigher cost, longer production timeFunctional studies requiring authentic protein modifications
Yeast (P. pastoris, S. cerevisiae)Eukaryotic processing, high yield, secretion capabilityDifferent glycosylation patternsStructural studies, high-throughput production
Cell-free systemsRapid production, suitable for toxic proteinsLower yield, higher costPreliminary functional assays, protein interaction studies
Drosophila S2 cellsNative environment, authentic processingLower yield compared to bacterial systemsStudies requiring native conformation and activity

Each system should be evaluated based on the specific research requirements, including protein folding, post-translational modifications, and downstream applications.

How can site-specific genomic targeting be used to study CG8303 function in Drosophila?

Site-specific genomic targeting provides a powerful approach to study CG8303 function through precise genetic modifications. The methodology involves:

  • Creation of a target vector containing FRT sites flanking the region of interest

  • Genomic integration of the target vector via piggyBac-mediated germ-line transformation

  • Introduction of a donor vector containing the modified CG8303 sequence

  • Co-injection with FLP recombinase to facilitate cassette exchange

  • Screening for successful recombinants using fluorescence markers

The cassette exchange system allows for:

  • Precise replacement of the endogenous CG8303 gene

  • Introduction of point mutations to study structure-function relationships

  • Integration of tagged versions for localization studies

  • Generation of conditional knockouts for temporal studies

This approach provides significant advantages over traditional P-element-based approaches, yielding targeted insertions at frequencies of approximately 23% .

What are the optimal conditions for expressing and purifying recombinant CG8303?

Based on experimental data and protein characteristics, the following conditions represent optimal parameters for CG8303 expression and purification:

ParameterOptimal ConditionRationale
Expression hostBL21(DE3) E. coliContains reduced protease activity and T7 RNA polymerase for high expression
Induction temperature18-20°CReduces inclusion body formation for this complex protein
Induction time16-18 hoursAllows sufficient time for proper folding
IPTG concentration0.2-0.5 mMBalances expression level with protein solubility
Lysis buffer50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM DTTMaintains protein stability during extraction
Purification methodNi-NTA affinity chromatography followed by size exclusionRemoves impurities and aggregates
Storage formLyophilized powder Ensures long-term stability

Optimization may be necessary depending on specific experimental requirements, with particular attention to maintaining the enzymatic activity of the reductase domain.

How can the enzymatic activity of CG8303 be measured and validated?

The putative fatty acyl-CoA reductase activity of CG8303 can be measured through several complementary approaches:

  • Spectrophotometric assays: Monitoring the consumption of NAD(P)H cofactor at 340 nm during the reduction reaction.

  • Radiometric assays: Using radiolabeled fatty acyl-CoA substrates (e.g., [14C]-palmitoyl-CoA) and measuring the formation of radiolabeled fatty alcohols by thin-layer chromatography or HPLC.

  • LC-MS/MS analysis: Quantification of substrate consumption and product formation using chromatographic separation coupled with mass spectrometry.

  • In vivo complementation: Testing whether expression of CG8303 can rescue phenotypes in mutant Drosophila lines or other organisms with deficiencies in fatty acyl-CoA reductase activity.

A validated assay should include:

  • Appropriate controls (heat-inactivated enzyme, known reductase inhibitors)

  • Substrate specificity determination (testing various chain length fatty acyl-CoAs)

  • Kinetic parameter determination (Km, Vmax)

  • Cofactor preference analysis (NADH vs. NADPH)

How should researchers interpret conflicting results when studying CG8303 function?

When encountering conflicting results in CG8303 functional studies, a systematic approach to data analysis is essential:

  • Compare experimental conditions: Minor variations in protein expression, purification, or assay conditions can significantly impact enzyme activity. Create a detailed comparison table of experimental parameters across studies.

  • Evaluate genetic background effects: When using Drosophila models, genetic background can influence phenotypic outcomes. Consider using standardized genetic backgrounds or multiple independent lines.

  • Assess technical limitations: Different methodologies have inherent limitations. For example:

    • In vitro biochemical assays may not reflect in vivo activity

    • Overexpression systems may cause artifactual results

    • RNAi approaches may have off-target effects

  • Perform statistical validation: Apply appropriate statistical tests to determine if differences are statistically significant, using tools such as chi-square analysis for genetic crosses .

  • Consider post-translational modifications: The functional activity of CG8303 may depend on specific modifications present in Drosophila but absent in heterologous expression systems.

A comprehensive approach would combine multiple techniques, including both in vitro biochemical assays and in vivo genetic approaches, to develop a consensus model of CG8303 function.

What visualization methods are most effective for presenting CG8303 research data?

Effective data visualization is critical for communicating CG8303 research findings. The appropriate visualization method depends on the specific data type:

  • For enzymatic kinetics data:

    • Michaelis-Menten plots for determining Km and Vmax values

    • Line graphs showing reaction velocity versus substrate concentration

    • Bar charts comparing activity across different substrates

  • For genetic analysis:

    • Tables presenting phenotypic ratios with expected versus observed values

    • Chi-square analysis tables for statistical validation

    • Punnett squares for inheritance patterns

  • For protein characterization:

    • Scatter plots showing the relationship between two continuous variables

    • Histograms for frequency distribution of continuous data

    • SDS-PAGE gel images with molecular weight markers

  • For phenotypic analysis:

    • Microscopy images with appropriate scale bars

    • Box plots or violin plots for quantitative phenotypic measurements

    • Heat maps for multi-parameter phenotypic comparisons

When creating tables for publication, ensure they include proper titles, column headings with measurement units, and appropriate statistical analyses (p-values) . Figures should be designed to stand alone with comprehensive legends that explain the experimental context and key findings.

How can CG8303 be used in comparative studies across Drosophila species?

CG8303 offers valuable opportunities for evolutionary and functional comparative studies across Drosophila species:

  • Sequence conservation analysis: Sequence alignment of CG8303 orthologs from multiple Drosophila species can identify:

    • Conserved catalytic residues essential for function

    • Species-specific variations that may correlate with metabolic adaptations

    • Evolutionary rates across different protein domains

  • Expression pattern comparison: Quantitative analysis of expression levels across species can reveal:

    • Developmental timing differences

    • Tissue-specific expression patterns

    • Sex-specific expression biases

  • Functional complementation experiments: Cross-species rescue experiments can determine:

    • Functional conservation of CG8303 activity

    • Species-specific substrate preferences

    • Adaptive changes in enzymatic efficiency

  • Phenotypic analysis in hybrid backgrounds: Creating chimeric proteins or performing cross-species expression can:

    • Identify species-specific interacting partners

    • Reveal adaptations in metabolic pathways

    • Uncover evolutionary constraints on protein function

These comparative approaches can provide insights into both the fundamental biochemical function of CG8303 and its potential role in adaptive evolution across Drosophila species.

What are the challenges in studying protein-protein interactions involving CG8303?

Investigating protein-protein interactions (PPIs) for CG8303 presents several specific challenges:

  • Membrane association: As a putative fatty acyl-CoA reductase, CG8303 likely associates with membrane compartments, complicating traditional PPI assays. Consider using:

    • Membrane-compatible crosslinking approaches

    • Detergent-based extraction methods optimized for hydrophobic proteins

    • Split-reporter systems designed for membrane-associated proteins

  • Dynamic interactions: Enzyme-substrate and enzyme-cofactor interactions are often transient, requiring specialized techniques:

    • Surface plasmon resonance for real-time interaction analysis

    • Hydrogen-deuterium exchange mass spectrometry for detecting conformational changes

    • Time-resolved FRET to capture transient interactions

  • Complex formation in different cellular compartments: CG8303 may form different complexes depending on subcellular localization. Methods to address this include:

    • Proximity labeling approaches (BioID, APEX)

    • Compartment-specific isolation followed by proteomics

    • In situ visualization using advanced microscopy techniques

  • Validation in Drosophila tissues: Confirming interactions identified in vitro within native Drosophila tissues requires:

    • Generation of tagged CG8303 variants using site-specific recombination techniques

    • Development of Drosophila-specific antibodies for co-immunoprecipitation

    • Genetic interaction studies to corroborate physical interactions

A multi-technique approach combining biochemical, genetic, and imaging methods is recommended for comprehensive characterization of CG8303 protein interactions.

How can polytene chromosome analysis be integrated with CG8303 functional studies?

Polytene chromosome analysis provides a powerful cytogenetic approach that can be integrated with CG8303 functional studies:

  • Chromosomal localization: Polytene chromosome staining using in situ hybridization can:

    • Precisely map the genomic location of CG8303

    • Identify potential regulatory regions

    • Detect chromosomal rearrangements affecting CG8303 expression

  • Transcriptional activity visualization: Utilizing the unique properties of Drosophila salivary gland polytene chromosomes:

    • Actively transcribed regions appear as chromosome puffs

    • RNA polymerase II staining can indicate CG8303 transcriptional status

    • Changes in puffing patterns under different conditions can reveal regulatory mechanisms

  • Chromatin state analysis: Immunostaining of polytene chromosomes with antibodies against:

    • Histone modifications (e.g., H3K4me3, H3K27ac) to assess chromatin state at the CG8303 locus

    • Chromatin remodeling factors to identify potential regulators

    • Transcription factors potentially controlling CG8303 expression

  • Methodology integration: The standard procedure for polytene chromosome preparation involves:

    • Isolation of salivary glands from third instar larvae

    • Fixation and staining with acetocarmine or other DNA stains

    • Microscopic analysis to visualize chromosome banding patterns

This approach can reveal connections between CG8303 expression, chromosomal organization, and phenotypic effects that may not be evident from biochemical or genetic studies alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.