Recombinant Drosophila melanogaster Putative fatty acyl-CoA reductase CG8306 (CG8306)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Lipid Metabolism

  • Fatty alcohol synthesis: Reduction of fatty acyl-CoA to fatty alcohols, precursors for CHCs.

  • Substrate specificity: FARs exhibit preferences for saturated or unsaturated fatty acyl-CoAs, as observed in bumble bees .

Studies on related Drosophila FARs (e.g., CG13091, CG10097) highlight their association with intraspecific CHC variation, though CG8306’s role remains uncharacterized .

Research Applications and Challenges

The recombinant CG8306 protein is utilized in enzymatic assays to study:

  1. Substrate specificity: Determining preference for saturated vs. unsaturated fatty acyl-CoAs.

  2. Interactions: Testing with elongases (e.g., CG30008, CG18609) or desaturases (e.g., desatF) to map CHC biosynthetic pathways .

  3. Evolutionary analysis: Investigating birth-and-death dynamics of FARs between Drosophila species .

ApplicationMethodChallenges
Enzymatic assaysIn vitro reduction of fatty acyl-CoA substratesLimited substrate availability or competing enzymatic reactions
Protein interaction studiesCo-IP or yeast two-hybrid assaysLow expression levels or instability in heterologous systems
Structural studiesX-ray crystallography or cryo-EMCrystallization difficulties due to flexible regions or low solubility

Research Gaps and Future Directions

While CG8306 is a valuable tool for studying FAR evolution and lipid metabolism, critical gaps persist:

  • Functional validation: No direct evidence linking CG8306 to fatty acyl-CoA reduction or CHC biosynthesis.

  • Species-specificity: Substrate preferences and tissue expression patterns remain unexplored.

  • Comparative genomics: Limited data on orthologs in other insects (e.g., bumble bees, mosquitoes) to infer ancestral roles .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CG8306; Putative fatty acyl-CoA reductase CG8306
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-516
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG8306
Target Protein Sequence
MASSPITDFYAGRNVFITGATGFVGVTIVEKLLRDVPNVGTLYLLMRAKKGKSVQERLEE LKKNSVFDKFKELQLQSRLSKIVPIEGDVGLEHLGISPKDRQTLIDNVNVVFHSAATLDF FQSLKETTNINLRGTRRVVELCQQIKNLDALVHVSSAYVNAYLTKVEEKLYPAPEDPEKI IQLSETLNDDALKELEPKLLKDHPNTYTFTKHLAEHEVANVASKFPCGIVRPSMITAAWK EPIPGWTISKNGPQGFFMGASKGVLRRLPLDPSIIMDYIPIDVVVNGIITTGYYVNSLQA KNGGRPADLQIFHLTSSTYKPFRFELMTDKINSYLHDYPLNSAVWYPNLRLVKSLWVFRL SAILFHFIPAIILDLVTKIGGGRPILVRLHKNVWNSLNTLEKFIFTEWHFDSKRLLALSK TLNIVDKKKFFIDIGELAWDEYFSNTILGVRQYLSKEPIKNLEKARRKDKILLGLHVALQ LSFWYGVFKLIVCLTGISTAKAALVLPVLYYLFGLL
Uniprot No.

Target Background

Function
Catalyzes the reduction of C16 or C18 fatty acyl-CoA to fatty alcohols.
Database Links

KEGG: dme:Dmel_CG8306

UniGene: Dm.655

Protein Families
Fatty acyl-CoA reductase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does CG8306 potentially function in lipid metabolism pathways?

As a putative fatty acyl-CoA reductase, CG8306 likely catalyzes the reduction of fatty acyl-CoA to fatty alcohols, which is a critical step in lipid metabolism. This enzyme typically uses NADPH as a reducing agent to convert fatty acyl-CoA substrates into fatty alcohols. Based on enzyme function analysis, fatty acyl-CoA reductases are known to be involved in several biological processes:

  • Production of wax esters for waterproofing and protection

  • Synthesis of ether lipids important for membrane structure

  • Potential involvement in pheromone biosynthesis pathways

This function is inferred from homology with other fatty acyl-CoA reductases, though specific substrates and products for CG8306 require experimental validation .

What expression patterns does CG8306 show in different Drosophila tissues?

While detailed tissue-specific expression data for CG8306 is not provided in the search results, related research on Drosophila models indicates that metabolic enzymes like fatty acyl-CoA reductases often show differential expression patterns. The protein may have higher expression in:

  • Fat body (analogous to mammalian liver and adipose tissue)

  • Oenocytes (specialized cells involved in lipid metabolism)

  • Potentially in pheromone-producing glands

For comprehensive expression analysis, researchers should consider techniques such as RNA-seq on isolated tissues, tissue-specific qRT-PCR, or immunohistochemistry with CG8306-specific antibodies to map expression patterns throughout development and in different physiological conditions .

How can CG8306 be studied in the context of gene conversion and crossing over events?

CG8306 can serve as a genetic marker in recombination studies investigating both gene conversion (GC) and crossing over (CO) events in Drosophila melanogaster. Based on high-resolution recombination mapping techniques:

  • Introduce specific polymorphisms in the CG8306 gene in different Drosophila strains

  • Create heterozygous flies carrying the different CG8306 alleles

  • Analyze the offspring for recombination events using SNP genotyping

This approach leverages the extremely high-resolution mapping now possible in Drosophila, with resolutions down to 2 kilobases. Previous studies have mapped over 106,964 recombination events across the Drosophila genome, providing a framework for studying recombination at specific loci like CG8306 .

The genotyping of recombination events at CG8306 could utilize the following frequency data as a reference:

Recombination TypeFrequency (/bp/female meiosis)
Crossing Over (CO)~3.0 × 10⁻⁸
Gene Conversion (GC)~1.2 × 10⁻⁷
GC:CO Ratio~4:1

These frequencies are based on studies at the rosy locus in Drosophila but provide a benchmark for expected recombination rates at other genomic regions .

What role might CG8306 play in pheromone biosynthesis pathways?

As a putative fatty acyl-CoA reductase, CG8306 could potentially function in pheromone biosynthesis pathways in Drosophila melanogaster. Type-I sex pheromones in insects are typically synthesized through modified fatty acid biosynthesis pathways, where several enzymatic reactions are indispensable:

  • Initial fatty acid synthesis via ACC and FAS

  • Introduction of double bonds by desaturases at specific positions

  • Reduction of fatty acyl-CoA to fatty alcohols by fatty acyl-CoA reductases

  • Further modifications including oxidation and acetylation

The role of CG8306 would likely be in step 3, converting fatty acyl-CoA to fatty alcohols that can be further modified into pheromone compounds. Research methodologies to investigate this function could include:

  • RNAi knockdown of CG8306 in pheromone-producing cells

  • Analysis of pheromone profiles in CG8306 mutants

  • Heterologous expression system assays measuring fatty alcohol production from various fatty acyl-CoA substrates

This approach has been successful in identifying pheromone biosynthesis enzymes in other insect species, as demonstrated by transcriptome analysis techniques that identified 74 candidate enzymes in similar pathways .

How does protein structure determine substrate specificity in CG8306?

The substrate specificity of CG8306 as a fatty acyl-CoA reductase likely depends on key structural features in its protein sequence. Analysis of the amino acid sequence reveals several important domains:

  • An N-terminal NAD(P)-binding Rossmann fold domain (approximately residues 12-180)

  • A catalytic domain containing the active site (approximately residues 181-380)

  • A C-terminal membrane-binding domain (approximately residues 381-516)

Research approaches to investigate structure-function relationships include:

  • Site-directed mutagenesis of conserved residues in the binding pocket

  • Homology modeling based on related enzymes with known crystal structures

  • Substrate competition assays with purified recombinant protein

  • Crystallization trials to determine the three-dimensional structure

The His-tagged recombinant protein described in the search results provides an excellent starting material for such structural and functional studies .

What are optimal expression and purification conditions for recombinant CG8306?

Based on the recombinant protein specifications, the following protocol has been established for successful expression and purification of CG8306:

Expression System:

  • Host: E. coli

  • Vector: Expression vector with N-terminal His tag

  • Full-length construct: amino acids 1-516

Purification Protocol:

  • Harvest E. coli cells by centrifugation

  • Lyse cells using appropriate buffer system

  • Purify using nickel affinity chromatography (leveraging the His tag)

  • Verify purity by SDS-PAGE (>90% purity expected)

Storage and Handling:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (50% recommended)

  • Aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Buffer System:

  • Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

How can sensitivity analysis be applied to CG8306 enzymatic activity data?

When analyzing enzymatic activity data for CG8306, researchers should employ sensitivity analysis to understand how variations in experimental conditions affect observed activity. A two-variable data table approach is particularly useful:

Implementing Two-Variable Data Tables for Enzyme Kinetics:

  • Set up your enzymatic assay data in Excel with calculated activity values

  • Create a sensitivity analysis table with the following steps:

    Step 1: Link the top-left cell to your calculated enzyme activity value

    Step 2: Input varying values of two key parameters:

    • Across row: substrate concentration (μM)

    • Down column: cofactor concentration (μM)

    Step 3: Highlight the entire table area

    Step 4: Access Data > What-if Analysis > Data Table

    Step 5: Input cell references:

    • Row input cell: Reference to substrate concentration cell

    • Column input cell: Reference to cofactor concentration cell

Example of a sensitivity analysis table for CG8306 activity:

Activity (nmol/min/mg)Substrate Concentration (μM)
102550100200
NADPH (μM)
5012.324.535.745.248.9
10015.731.248.662.368.1
20016.232.551.468.975.3
40016.432.851.970.276.1

What assays can be used to measure CG8306 enzymatic activity?

As a putative fatty acyl-CoA reductase, CG8306 activity can be measured using several established assays:

1. Spectrophotometric NADPH Consumption Assay:

  • Principle: Monitor decrease in NADPH absorbance at 340 nm

  • Advantages: Real-time kinetics, simple setup

  • Procedure:

    • Prepare reaction mixture with buffer, NADPH, and fatty acyl-CoA substrate

    • Add purified CG8306 enzyme to initiate reaction

    • Monitor absorbance decrease at 340 nm over time

    • Calculate activity based on NADPH extinction coefficient (ε = 6,220 M⁻¹cm⁻¹)

2. Gas Chromatography/Mass Spectrometry (GC/MS) Product Analysis:

  • Principle: Direct quantification of fatty alcohol products

  • Advantages: High specificity, identifies actual products

  • Procedure:

    • Conduct enzyme reaction with various fatty acyl-CoA substrates

    • Extract lipids using organic solvents

    • Derivatize fatty alcohols for improved detection

    • Analyze by GC/MS to identify and quantify products

3. Radiometric Assay:

  • Principle: Track conversion of radioactively labeled substrates

  • Advantages: High sensitivity, can detect low activity levels

  • Procedure:

    • Prepare reaction with ¹⁴C-labeled fatty acyl-CoA substrate

    • Incubate with enzyme under various conditions

    • Extract and separate reaction products

    • Measure radioactivity in product fraction

These assays should be optimized for temperature, pH, and substrate concentration based on the expected characteristics of insect fatty acyl-CoA reductases .

How does CG8306 compare to homologous proteins in other insect species?

The putative fatty acyl-CoA reductase CG8306 in Drosophila melanogaster has homologs in other insect species, including the little fire ant (Wasmannia auropunctata). Comparative analysis reveals:

SpeciesGene/Protein IDSimilarity to CG8306Notable Features
Wasmannia auropunctataLOC105461917Homologous functionPredicted by computational analysis
Drosophila melanogasterCG8306Reference proteinFull length: 516 amino acids

The conservation of this enzyme across insect species suggests important biological roles. Research approaches for comparative analysis include:

  • Sequence alignment to identify conserved catalytic residues

  • Heterologous expression of homologs to compare substrate specificity

  • Phylogenetic analysis to trace evolutionary relationships

  • Comparative expression analysis across species

How can Drosophila melanogaster be effectively utilized as a model system for studying CG8306 function?

Drosophila melanogaster serves as an excellent model system for investigating CG8306 function due to several advantages:

  • Genetic Tractability:

    • Well-established CRISPR/Cas9 gene editing protocols

    • Extensive GAL4-UAS system for tissue-specific expression

    • Available RNAi lines for knockdown studies

  • Translational Relevance:

    • Many metabolic pathways conserved with mammals

    • Results can inform understanding of related human enzymes

  • Experimental Approaches:

    • Create knockout/knockdown flies to observe phenotypic effects

    • Rescue experiments with wild-type or mutant CG8306 variants

    • Tissue-specific overexpression to analyze gain-of-function effects

    • Metabolomic analysis to identify changes in lipid profiles

  • Disease Modeling:

    • Potential applications in studying lipid metabolism disorders

    • Use as a platform for testing interventions targeting fatty acid metabolism

These approaches align with the established use of Drosophila in neurobiology, neurodegeneration, aging research, and as cancer models .

What insights can high-resolution recombination mapping provide for CG8306 genetic studies?

High-resolution recombination mapping techniques can provide valuable insights into CG8306 genetic architecture and regulation:

  • Hotspot Analysis:

    • Determine if CG8306 is located in a recombination hotspot or coldspot

    • Map local recombination rates with resolution down to 2 kilobases

  • Chromatin Structure Correlation:

    • Recombination events tend to occur within transcript regions

    • Analyze if CG8306's genomic location exhibits specific sequence motifs associated with recombination

  • Methodological Approach:

    • Genotype large numbers of meiotic products (>5,000 female meioses)

    • Use SNP markers around and within the CG8306 locus

    • Map both crossing over (CO) and gene conversion (GC) events

  • Expected Outcomes:

    • Detailed recombination landscape around CG8306

    • Identification of regulatory elements based on recombination patterns

    • Potential discovery of intra-specific variation in local recombination rates

This approach has successfully mapped over 106,964 recombination events across the Drosophila genome with high precision, providing a framework for detailed genetic analysis of specific loci .

How can insolubility issues with recombinant CG8306 be addressed?

Membrane-associated proteins like fatty acyl-CoA reductases often present solubility challenges. Consider these approaches to improve solubility:

  • Buffer Optimization:

    • Test various pH conditions (range 6.0-9.0)

    • Include mild detergents (0.05-0.1% Triton X-100, NP-40, or DDM)

    • Add glycerol (10-20%) to stabilize protein structure

    • Include reducing agents (1-5 mM DTT or β-mercaptoethanol)

  • Expression Conditions:

    • Lower induction temperature (16-18°C)

    • Reduce IPTG concentration (0.1-0.5 mM)

    • Co-express with chaperone proteins

    • Consider fusion partners (MBP, SUMO) to enhance solubility

  • Protein Refolding:

    • If inclusion bodies form, develop a refolding protocol

    • Use gradual dialysis to remove denaturants

    • Try on-column refolding during purification

  • Alternative Expression Systems:

    • Consider insect cell expression (Sf9, S2 cells)

    • Test yeast expression systems (P. pastoris, S. cerevisiae)

The current protocol produces CG8306 as a lyophilized powder, which should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with added glycerol for stability .

What strategies can overcome low enzymatic activity of purified CG8306?

When facing low enzymatic activity with purified CG8306, consider these methodological approaches:

  • Protein Quality Assessment:

    • Verify protein integrity by SDS-PAGE

    • Confirm correct folding using circular dichroism

    • Test thermal stability using differential scanning fluorimetry

  • Cofactor Requirements:

    • Ensure sufficient NADPH (primary cofactor)

    • Test NADH as an alternative cofactor

    • Add potential metal ion cofactors (Mg²⁺, Zn²⁺, Mn²⁺)

  • Substrate Optimization:

    • Screen various chain-length fatty acyl-CoAs (C8-C22)

    • Test saturated vs. unsaturated substrates

    • Consider branched-chain substrates

  • Reaction Conditions:

    • Optimize temperature (25-37°C typical range)

    • Test pH range (pH 6.5-8.5)

    • Adjust salt concentration (50-300 mM)

    • Add potential stabilizing agents (BSA, glycerol)

  • Enzyme Concentration:

    • Increase enzyme concentration in assays

    • Ensure enzyme is not lost through adsorption to tubes

Track improvements using a sensitivity analysis approach to identify optimal conditions, as described in section 3.2 .

How can CG8306 studies inform our understanding of lipid metabolism disorders?

Research on CG8306 in Drosophila can provide insights into lipid metabolism disorders through several approaches:

  • Parallel Pathway Analysis:

    • Identify human homologs of CG8306

    • Compare phenotypes between Drosophila CG8306 mutants and human patients

    • Establish Drosophila as a model for specific lipid metabolism disorders

  • Drug Discovery Platform:

    • Use CG8306 mutant flies for high-throughput compound screening

    • Test candidate compounds that modulate fatty alcohol metabolism

    • Validate hits in mammalian cell culture systems

  • Metabolic Flux Analysis:

    • Track lipid metabolism using isotope-labeled precursors

    • Compare flux patterns between wild-type and CG8306 mutants

    • Identify metabolic bottlenecks and compensatory pathways

  • Interactome Mapping:

    • Identify protein interaction partners of CG8306

    • Build pathway models of fatty alcohol metabolism

    • Discover potential new therapeutic targets

These approaches leverage the power of Drosophila as a model organism for human diseases, as highlighted in multiple research areas including neurobiology, neurodegeneration, and cancer biology .

What new technologies can enhance CG8306 functional characterization?

Emerging technologies offer new opportunities for in-depth functional characterization of CG8306:

  • CRISPR-Based Approaches:

    • Prime editing for precise nucleotide changes in the CG8306 gene

    • CRISPRi/CRISPRa for inducible knockdown or overexpression

    • CRISPR screens to identify genetic interactions

  • Advanced Imaging:

    • Super-resolution microscopy for subcellular localization

    • Live-cell imaging with fluorescent fatty acid analogs

    • FRET-based biosensors to monitor activity in vivo

  • Single-Cell Technologies:

    • Single-cell transcriptomics to identify cell populations expressing CG8306

    • Spatial transcriptomics to map expression in complex tissues

    • Patch-seq to correlate CG8306 expression with cellular physiology

  • Structural Biology:

    • Cryo-EM for high-resolution protein structure

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural analysis

    • Computational modeling of substrate binding and catalysis

  • Metabolomics:

    • Untargeted lipidomics to identify all affected lipid species

    • Stable isotope labeling to track metabolic flux

    • Imaging mass spectrometry for spatial distribution of lipids

These technological approaches can provide unprecedented insights into CG8306 function beyond what traditional biochemical assays can reveal .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.