Recombinant Drosophila melanogaster Putative gustatory receptor 22a (Gr22a)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Gr22a

Gr22a is encoded by the Gr22a gene (CG31662, UniProt ID: P58951) and is part of the Gr28 subfamily. Key features include:

PropertyDetails
Gene LocationChromosome 3R (Drosophila genome)
Protein Length394 amino acids (Full-length recombinant form)
Host SystemsE. coli, Yeast, Baculovirus, Mammalian Cells, Cell-Free Expression
Purity≥85–90% (verified by SDS-PAGE)
Structural Motifs7 transmembrane domains, ligand-gated ion channel architecture

The recombinant protein is produced with tags (e.g., His-tag) for purification and detection . Its amino acid sequence begins with MSQPKRIHRICKGL... and includes conserved regions critical for ligand binding .

Functional Role in Chemosensation

Gr22a is implicated in both attractive and aversive taste behaviors:

Key Findings from In Vivo Studies

  • Opposing Behavioral Valence:

    • Gr28a-expressing neurons drive attraction to nutritious compounds (e.g., RNA) .

    • Gr28b.c-expressing neurons mediate avoidance of bitter substances like denatonium benzoate and quinine .

  • Ligand Specificity:

    • Gr22a-containing receptors detect denatonium, a synthetic bitter compound structurally similar to plant alkaloids .

    • Calcium imaging shows Gr28b.c neurons exhibit reduced responses to denatonium in Gr28 mutants .

LigandBehavioral ResponseNeuronal Pathway
Denatonium benzoateAvoidanceGr28b.c GRNs
RNAAttractionGr28a GRNs
Capsaicin (via VR1)Context-dependentGr28a (attraction) vs. Gr28b.c (avoidance)

Recombinant Production and Applications

Recombinant Gr22a is commercially available for experimental use:

Available Recombinant Products

ProductHostTagApplications
Recombinant Gr22a (Full-length, His-tagged)E. coliHisELISA, WB, functional assays
Recombinant Gr22a (Partial, untagged)Mammalian CellsNoneStructural studies
Rabbit anti-Gr22a Polyclonal AntibodyRabbitIgGImmunodetection

Research Applications

  • Ligand Screening: Used to identify agonists/antagonists via calcium imaging .

  • Behavioral Studies: Transgenic expression in heterologous neurons (e.g., VR1) to dissect taste circuits .

  • Structural Biology: Analysis of transmembrane domain interactions .

Evolutionary and Ecological Significance

Gr22a is evolutionarily conserved across insects for over 260 million years, highlighting its role in survival . In Drosophila, it enables discrimination between nutritious and toxic compounds, a mechanism critical for larval development and foraging .

Open Questions and Future Directions

  • Receptor Complex Composition: Whether Gr22a functions as a homomer or requires co-receptors (e.g., Gr66a) remains unresolved .

  • Downstream Signaling: Mechanisms linking Gr22a activation to neural circuit modulation are poorly understood .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery timelines, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by numerous factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Gr22a; CG31662; Putative gustatory receptor 22a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-394
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr22a
Target Protein Sequence
MSQPKRIHRICKGLARFTIRATLYGSWVLGLFPFTFDSRKRRLNRSKWLLAYGLVLNLTL LVLSMLPSTDDHNSVKVEVFQRNPLVKQVEELVEVISLITTLVTHLRTFSRSSELVEILN ELLVLDKNHFSKLMLSECHTFNRYVIEKGLVIILEIGSSLVLYFGIPNSKIVVYEAVCIY IVQLEVLMVVMHFHLAVIYIYRYLWIINGQLLDMASRLRRGDSVDPDRIQLLLWLYSRLL DLNHRLTAIYDIQVTLFMATLFSVNIIVGHVLVICWINITRFSLLVIFLLFPQALIINFW DLWQGIAFCDLAESTGKKTSMILKLFNDMENMDQETERRVTEFTLFCSHRRLKVCHLGLL DINYEMGFRMIITNILYVVFLVQFDYMNLKFKTD
Uniprot No.

Target Background

Function
This protein is a probable gustatory receptor that mediates acceptance or avoidance behavior in *Drosophila melanogaster*, depending on its substrates.
Database Links

KEGG: dme:Dmel_CG31662

STRING: 7227.FBpp0077565

UniGene: Dm.26376

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr22e subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in neurons of the terminal external chemosensory organ of larvae.

Q&A

What is Gr22a and what is its structural composition?

Gr22a (Putative gustatory receptor 22a) is a chemosensory receptor protein found in Drosophila melanogaster with UniProt accession number P58951. Structurally, it consists of 394 amino acids with a complex sequence containing multiple transmembrane domains. The full-length protein contains several hydrophobic regions characteristic of membrane-spanning segments, consistent with its role as a sensory receptor. The amino acid sequence includes regions critical for ligand binding and signal transduction that are conserved across gustatory receptors .

Where is Gr22a expressed in Drosophila melanogaster?

Gr22a is primarily expressed in gustatory sensory neurons found in various chemosensory organs of Drosophila. Expression has been detected in the labellum (the fly's equivalent of a tongue), the labral sense organ (LSO) that lines the pharynx, and in the terminal organ of larvae. Unlike some other gustatory receptors that are widely distributed, Gr22a shows a more restricted expression pattern, typically in a small fraction (approximately 1-4%) of gustatory sensilla in spatially defined regions of the fly .

How does Gr22a differ from odorant receptors like Or22a?

Despite their similar nomenclature, Gr22a (gustatory receptor) and Or22a (odorant receptor) belong to different receptor families with distinct functions. Or22a responds primarily to volatile esters and alcoholic compounds and is expressed in olfactory sensory neurons in the antenna. In contrast, Gr22a functions as a taste receptor responding to non-volatile compounds. Their trafficking mechanisms also differ—recent research indicates that Or22a reaches cilia partially through unconventional secretory pathways that bypass the classic ER-Golgi route, while gustatory receptors may follow different trafficking pathways . Additionally, neurons expressing Or22a project to specific glomeruli in the antennal lobe, while Gr22a-expressing gustatory neurons typically project to the subesophageal ganglion .

What are the optimal storage conditions for recombinant Gr22a protein?

For optimal preservation of recombinant Gr22a protein, storage at -20°C or -80°C is recommended. The shelf life is approximately 6 months for liquid formulations and 12 months for lyophilized forms when stored at these temperatures. Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided to maintain protein integrity. For long-term storage, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol (final concentration) is recommended before aliquoting .

What methods are most effective for studying Gr22a expression patterns?

Multiple complementary techniques have proven effective for studying Gr22a expression:

  • RT-PCR amplification: Particularly useful for detecting expression in small, surgically excised tissues like the labral sense organ (LSO), where expression levels may be exceedingly low .

  • Transgenic reporter systems: Utilizing Gr22a promoter-Gal4 fusion constructs coupled with UAS-GFP or UAS-LacZ allows visualization of Gr22a-expressing cells in live tissues. This approach has successfully revealed expression in single neurons within the terminal organ of larvae .

  • In situ hybridization: Though challenging due to low expression levels of gustatory receptor genes, this technique can localize Gr22a mRNA in specific cells when optimized for sensitivity .

  • Immunolocalization: When combined with neuronal markers, this approach helps establish the identity of Gr22a-expressing cells within complex sensory organs .

What experimental design considerations are essential for functional studies of Gr22a?

When designing experiments to study Gr22a function, researchers should consider:

  • Control selection: Proper negative and positive controls are critical. For behavioral assays, comparing wild-type, Gr22a mutant, and rescue lines is essential to establish causality .

  • Variable isolation: Carefully control environmental factors that might influence chemosensory responses, including temperature, humidity, and prior feeding state of the flies .

  • Statistical power: Due to variability in behavioral responses, sufficient replication is necessary with recommended sample sizes determined through power analysis .

  • Stimulus presentation: Standardize the concentration, purity, and delivery method of chemical stimuli to ensure reproducibility. Consider dose-response relationships rather than single-concentration testing .

  • Multimodal interactions: Design experiments that can distinguish between unimodal and multimodal responses, as recent evidence suggests that some gustatory neurons might respond to compounds of different taste modalities .

How can calcium imaging be optimized to study Gr22a neural responses in Drosophila larvae?

Calcium imaging offers valuable insights into gustatory receptor function but requires specific optimization for the Drosophila larval system. Based on recent methodological advances, researchers should:

  • Utilize genetically encoded calcium indicators (GECIs) such as GCaMP variants driven by the Gr22a promoter to achieve cell-specific expression.

  • Develop appropriate immobilization techniques that maintain physiological integrity while allowing stimulus delivery. This can involve custom microfluidic chambers that permit controlled stimulus application while keeping larvae partially restrained .

  • Implement rapid imaging protocols with high temporal resolution (≥10 Hz) to capture the often transient calcium responses to gustatory stimuli.

  • Include controls for mechanical stimulation, as larval gustatory neurons may respond to both chemical and mechanical cues.

  • Consider comparing responses across different developmental stages, as the study by van Giesen et al. demonstrates that larval gustatory neurons may employ different coding strategies than adult neurons .

What approaches can resolve contradictory findings regarding Gr22a ligand specificity?

Contradictory results regarding Gr22a ligand specificity may stem from methodological differences or biological complexities. To address these inconsistencies, researchers should:

  • Employ heterologous expression systems (e.g., empty neuron or cell culture systems) to test direct receptor-ligand interactions without interference from other chemoreceptors.

  • Conduct dose-response analyses across a wide concentration range, as receptor responses may vary significantly with ligand concentration.

  • Compare in vivo and in vitro findings to identify potential modulatory effects from accessory proteins or cellular context.

  • Consider multimodal coding possibilities, as recent evidence suggests that some gustatory neurons may respond to compounds of different taste modalities with opposing valence (e.g., both bitter and sweet compounds) .

  • Examine potential heteromeric receptor configurations, as gustatory receptors often function as heteromultimers rather than homomeric complexes.

How might unconventional trafficking pathways impact Gr22a function?

Recent research on odorant receptor trafficking, particularly Or22a, has revealed unconventional secretory pathways that bypass the classical ER-Golgi route. For Gr22a research, this raises important questions:

  • Does Gr22a utilize similar unconventional trafficking mechanisms? The study by Dzaki and Alenius (2024) demonstrated that Or22a frequently presents as puncta that rarely coincide with ERGIC or Golgi markers, suggesting Golgi-independent transport .

  • Researchers could apply similar methodological approaches to study Gr22a trafficking, including colocalization studies with markers like Grasp65 (a marker of unconventional pathway) under various conditions, including nutritional starvation which enhances Golgi-bypassing secretory activity .

  • The potential impact of trafficking pathways on receptor function, localization, and stimulus sensitivity remains to be determined for Gr22a and may represent an important regulatory mechanism for gustatory sensation.

What role might Gr22a play in multimodal sensory integration in Drosophila larvae?

Recent findings suggest that gustatory neurons in Drosophila larvae may employ a surprisingly different mode of gustatory information coding compared to adults. While adult gustatory receptor neurons (GRNs) typically perceive chemical stimuli of one specific gustatory modality, larval GRNs may be multimodal:

  • Research by van Giesen et al. identified a multimodal GRN that responds to chemicals of different taste modalities with opposing valence, such as sweet sucrose and bitter denatonium .

  • Future studies should investigate whether Gr22a-expressing neurons exhibit similar multimodal properties and how this affects behavioral responses.

  • Experimental approaches should combine electrophysiology, calcium imaging, and behavioral assays to correlate receptor activation with downstream neural processing and behavioral output.

  • Genetic manipulation techniques, including cell-specific knockout and rescue experiments, could help determine if Gr22a plays a role in integrating diverse chemical cues in larval sensory systems.

What methodological considerations are important when using recombinant Gr22a for ELISA-based assays?

When utilizing recombinant Gr22a for ELISA-based applications, researchers should consider:

  • Protein preparation: Recombinant Gr22a should be reconstituted according to manufacturer recommendations, typically in deionized sterile water to a concentration of 0.1-1.0 mg/mL with added glycerol for stability .

  • Purity assessment: Confirm protein purity (>85% by SDS-PAGE is standard) before use in sensitive assays .

  • Blocking optimization: Due to the hydrophobic nature of membrane proteins like Gr22a, standard blocking agents may need optimization to minimize background without interfering with epitope recognition.

  • Antibody validation: When using antibodies against Gr22a, extensive validation is required due to the typically low expression levels of gustatory receptors in vivo.

  • Controls: Include appropriate positive and negative controls, especially considering the multimodal response properties that might be associated with this receptor .

How can researchers effectively design experiments to detect the low expression levels typical of gustatory receptor genes?

The extremely low expression levels of gustatory receptor genes, including Gr22a, present significant technical challenges. Effective experimental approaches include:

  • Tissue enrichment strategies: Surgical microdissection of specific sensory organs (as demonstrated for the labral sense organ) can enrich for gustatory receptor-expressing cells before RNA extraction .

  • Highly sensitive RT-PCR protocols: Optimized for low-abundance transcripts, potentially including nested PCR approaches or digital PCR for absolute quantification.

  • Single-cell transcriptomics: This approach can identify Gr22a expression in individual sensory neurons, overcoming the dilution effect that occurs in whole-tissue RNA preparations.

  • Reporter gene amplification systems: Utilizing the GAL4-UAS system with multiple UAS binding sites can amplify the detection signal even when the natural promoter drives low expression levels .

  • RNAscope or other high-sensitivity in situ hybridization techniques: These methods can detect low-abundance transcripts with improved signal-to-noise ratios compared to traditional in situ hybridization approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.