Recombinant Drosophila melanogaster Putative gustatory receptor 22b (Gr22b)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bitter Compound Detection

Gr22b is implicated in detecting bitter-tasting compounds, a critical survival mechanism for avoiding toxins . Key findings include:

Ectopic Expression Studies

  • Neuronal Activation: Expression of Gr22b in non-bitter-sensing neurons (e.g., sweet-sensing I-a sensilla) conferred novel responses to aversive compounds:

    • Sucrose octaacetate (SOA): Spike rate increased from 0 to ~20 spikes/s .

    • Cucurbitacin (CUC) and Azadirachtin (AZA): Dose-dependent responses absent in control neurons .

  • Specificity: Gr22b did not respond to other bitter ligands (e.g., caffeine or theophylline), indicating ligand selectivity .

Native Context

  • Endogenous Expression: Gr22b is natively expressed in bitter-sensitive S-a labellar sensilla, which respond to SOA, CUC, and AZA .

  • Genetic Variability: Initially misannotated as a pseudogene due to a premature stop codon in some strains (e.g., reference genome), but functional in wild-type D. melanogaster (e.g., Oregon-R) .

Comparative Analysis with Related Receptors

Gr22b belongs to a gene cluster including Gr22f, but their functions diverge:

FeatureGr22bGr22f
Gene IDCG31931CG31932
Ligand SpecificitySOA, CUC, AZA Undetermined (limited functional data)
Antibody AvailabilityPolyclonal antibodies validated for ELISA/WB Polyclonal antibodies available

Research Applications

  • Ligand Screening: Used to identify novel agonists/antagonists via heterologous expression .

  • Neural Circuit Mapping: Expression in transgenic flies reveals how bitter signals are processed .

  • Evolutionary Studies: Comparative genomics highlight Gr22b’s role in adaptive responses to plant toxins .

Controversies and Clarifications

  • Pseudogene Misannotation: Early genome annotations flagged Gr22b as nonfunctional due to a premature stop codon in the reference strain. Sequencing of Oregon-R confirmed intact coding regions, resolving this discrepancy .

  • Functional Redundancy: Unlike Gr22a/Gr22b odorant receptors, Gr22b operates independently in bitter detection without requiring co-receptors .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary based on your purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please contact us in advance for arrangements. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage state, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gr22b; CG31931; Putative gustatory receptor 22b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr22b
Target Protein Sequence
MFGSSREIRPYLARQMLKTTLYGSWLLGIFPFTLDSGKRIRQLRRSRCLTLYGLVLNYFL IFTLIRLAFEYRKHKLEAFKRNPVLEMINVVIGIINVLSALIVHFMNFWGSRKVGEICNE LLILEYQDFEGLNGRNCPNFNCFVIQKCLTILGQLLSFFTLNFALPGLEFHICLVLLSCL MEFSLNLNIMHYHVGVLLIYRYVWLINEQLKDLVSQLKLNPETDFSRIHQFLSLYKRLLE LNRKLVIAYEYQMTLFIIAQLSGNIVVIYFLIVYGLSMRTYSIFLVAFPNSLLINIWDFW LCIAACDLTEKAGDETAIILKIFSDLEHRDDKLEMSVNEFAWLCSHRKFRFQLCGLFSMN CRMGFKMIITTFLYLVYLVQFDYMNL
Uniprot No.

Target Background

Function
This protein is a probable gustatory receptor that mediates acceptance or avoidance behavior depending on its substrates. It appears to be involved in the sensing of bitter taste as it is expressed in neurons that mediate sensitivity to bitter compounds.
Database Links

KEGG: dme:Dmel_CG31931

STRING: 7227.FBpp0099546

UniGene: Dm.30798

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr22e subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in taste bristles in the foreleg and labial palps. In larvae, is expressed in neurons of the dorsal and posterior pharyngeal sense organs. Expressed in taste neurons that mediate sensitivity to bitter compounds.

Q&A

Where is Gr22b expressed in Drosophila and how can researchers detect this expression?

Based on general patterns of GR expression, Gr22b is likely expressed in gustatory sensilla found in major taste organs of Drosophila. The primary method for detecting Gr expression is through RT-PCR amplification, which has been successfully used to detect GR transcripts in taste organs such as the labral sense organ (LSO). Most GR genes are expressed in a very small fraction (1%-4%) of gustatory sensilla in spatially restricted regions of the fly, making their detection challenging. In situ hybridization can also be used to visualize expression patterns, though expression levels of GR genes are typically exceedingly low, which explains why no expressed sequence tags have been identified for many GR transcripts .

What is the genomic organization of Gr22b and how does it relate to Gr22d?

Gr22b appears to be genomically linked to Gr22d, as they are frequently mentioned together in genetic descriptions (e.g., "Gr22b Gr22d cn CG33964[R4.2]") . This suggests they may be part of a tandem array, which is common for GR genes. Within the GR family, 22 genes reside as individual sequences distributed throughout Drosophila chromosomes, while the remaining genes are linked in small tandem arrays. These linked genes often show higher sequence similarity (30%-50% identity), potentially forming discrete subfamilies with related functions .

What are the most effective techniques for generating recombinant Gr22b for functional studies?

For recombinant expression of Gr22b, researchers commonly use either heterologous expression systems (such as Drosophila S2 cells) or in vivo expression using the GAL4-UAS system. When expressing GRs in S2 cells, it's crucial to co-express multiple receptor subunits, as functional taste receptors often require multiple GR proteins to form a working complex. For example, studies with other GRs (such as GR8a, GR66a, and GR98b) have shown that co-expression of all three receptors in S2 cells was necessary to induce ligand-activated responses .

The general protocol involves:

  • Cloning the Gr22b coding sequence into an appropriate expression vector

  • Transfecting cells or generating transgenic flies

  • Confirming expression through RT-PCR, immunohistochemistry, or reporter gene expression

  • Conducting functional assays to test receptor activity

Note that GR protein expression is typically very low, so sensitive detection methods are essential for verification.

How can researchers validate the functional expression of recombinant Gr22b?

Validation of functional Gr22b expression requires a multi-step approach:

  • Molecular verification: Confirm transcript expression through RT-PCR and quantitative PCR.

  • Protein localization: Use epitope tagging (HA, FLAG, etc.) followed by immunohistochemistry to verify protein expression and membrane localization.

  • Reporter gene expression: Utilize the GAL4-UAS system with a Gr22b promoter-GAL4 construct driving a UAS-GFP or UAS-LacZ reporter to visualize expression patterns in transgenic flies.

  • Functional validation: Perform electrophysiological recordings (tip recordings from taste sensilla) or calcium imaging to test whether cells expressing Gr22b respond to potential ligands.

  • Behavioral assays: Conduct feeding preference tests with Gr22b-expressing or Gr22b mutant flies to correlate receptor expression with behavioral outcomes.

Similar approaches with other GRs have successfully demonstrated that neurons expressing the same receptor project to spatially invariant regions in the brain, confirming the functional organization of the gustatory system .

What considerations should be taken when designing experiments to study Gr22b interaction with other gustatory receptors?

When investigating Gr22b interactions with other GRs, researchers should consider:

  • Receptor co-expression patterns: Determine whether Gr22b is naturally co-expressed with other GRs in the same neurons using dual-label in situ hybridization or reporter gene expression.

  • Combinatorial approach: Based on studies of other GRs, functional taste receptors often require multiple subunits. For example, the L-canavanine receptor requires three GRs (GR8a, GR66a, and GR98b) to function properly . Therefore, systematic co-expression of Gr22b with various combinations of other GRs is recommended.

  • Protein interaction studies: Use co-immunoprecipitation, proximity ligation assays, or FRET/BRET techniques to demonstrate physical interaction between Gr22b and other candidate receptor subunits.

  • Functional redundancy: Consider possible functional redundancy with closely related GRs, particularly those in the same genomic cluster (e.g., Gr22d).

  • Cellular context: The cellular environment can affect receptor interactions; therefore, both heterologous expression systems and in vivo studies should be employed to validate interactions.

By systematically testing these interactions, researchers can determine the complete subunit composition required for Gr22b function, similar to how GR8a, GR66a, and GR98b were identified as the components of the L-canavanine receptor .

What is known about the ligands or tastants that activate Gr22b-containing receptors?

To identify potential ligands for Gr22b, researchers should:

  • Conduct high-throughput screening of diverse chemical compounds using cells expressing Gr22b (potentially in combination with other GRs).

  • Perform electrophysiological recordings from taste sensilla that express Gr22b in response to various tastants.

  • Use calcium imaging to visualize neural activity in Gr22b-expressing cells upon stimulation with candidate tastants.

  • Conduct behavioral assays comparing wild-type flies with Gr22b mutants to identify compounds that elicit differential responses.

It's important to note that Gr22b likely functions as part of a receptor complex, so experiments should consider potential co-receptors when testing candidate ligands.

How does Gr22b contribute to the behavioral response to aversive compounds?

While the specific role of Gr22b in aversive taste responses is not directly addressed in the search results, we can outline research approaches to investigate this question based on studies of other GRs:

  • Generate Gr22b mutants: Create specific gene knockouts or use RNAi to downregulate Gr22b expression.

  • Behavioral preference assays: Conduct two-choice feeding assays comparing preferences of wild-type and Gr22b-deficient flies for various compounds. This approach has been successful in demonstrating that GR8a, GR66a, and GR98b are required for L-canavanine avoidance .

  • Proboscis extension reflex (PER) assays: Measure the inhibition of proboscis extension in response to various bitter compounds in wild-type versus Gr22b mutant flies.

  • Context-dependent taste perception: Test whether Gr22b contributes to taste perception differently depending on the nutritional state of the fly, as Drosophila can sense nutritional content independent of taste detection .

  • Neuronal activation/silencing: Use optogenetic or thermogenetic tools to activate or silence Gr22b-expressing neurons and observe behavioral outcomes.

These approaches would help clarify whether Gr22b is involved in detecting specific aversive compounds and how its activation translates to avoidance behavior.

How do the projections of Gr22b-expressing neurons compare to those expressing other gustatory receptors?

To specifically map Gr22b neuronal projections, researchers should:

  • Generate transgenic flies expressing a Gr22b promoter-GAL4 fusion crossed with UAS-nSyb-GFP or similar reporters to visualize axonal projections.

  • Use confocal microscopy to trace the projections from Gr22b-expressing sensory neurons to their targets in the brain.

  • Perform dual-labeling experiments to compare Gr22b projections with those of neurons expressing other GRs.

  • Investigate whether Gr22b-expressing neurons form a labeled line for specific taste modalities by correlating their projection patterns with behavioral responses.

Understanding these projection patterns would provide insight into how Gr22b contributes to taste coding in the Drosophila brain.

What are the recommended experimental designs for investigating Gr22b contribution to sensory integration and decision-making?

To investigate how Gr22b contributes to sensory integration and decision-making, researchers should consider multi-level experimental designs:

  • Circuit mapping: Use trans-synaptic tracers (such as trans-Tango) to identify second and third-order neurons connected to Gr22b-expressing sensory neurons.

  • Functional connectivity: Employ calcium imaging to visualize activity patterns in higher-order neurons following activation of Gr22b-expressing neurons.

  • Competing sensory inputs: Design experiments where Gr22b-mediated aversive stimuli compete with attractive stimuli detected by other receptors. For example, studies with other GRs have shown that ectopic expression of GR8a, GR66a, and GR98b in sweet-sensing GRNs can switch L-canavanine from an aversive to an attractive compound . Similar experiments with Gr22b could reveal how sensory information is integrated.

  • Temporal dynamics: Investigate how prolonged or repeated activation of Gr22b-expressing neurons affects downstream signaling and behavioral outputs over time.

  • Context-dependent modulation: Test how internal states (hunger, thirst) or prior experience modulate the behavioral impact of Gr22b activation.

  • Computational modeling: Develop models that predict how Gr22b-mediated inputs are integrated with other sensory information to produce behavioral decisions.

These approaches would help elucidate how Gr22b-mediated sensory information is processed and integrated into the fly's decision-making processes.

How can researchers address data discrepancies in electrophysiological recordings from Gr22b-expressing gustatory receptor neurons?

Electrophysiological recordings from gustatory receptor neurons (GRNs) can present several challenges and potential discrepancies. To address these issues, researchers should:

  • Standardize preparation techniques: Ensure consistent methods for proboscis/labellum preparation and electrode positioning.

  • Control for genetic background: Use appropriate genetic controls with identical backgrounds except for the Gr22b manipulation.

  • Account for neuronal variability:

    • Increase sample size to account for natural variability between GRNs

    • Record from precisely identified sensilla

    • Report data from individual sensilla rather than pooling responses

  • Consider multiple parameters: Analyze various aspects of neuronal responses:

    • Spike frequency (spikes/second)

    • Latency to first spike

    • Response duration

    • Adaptation patterns

  • Statistical approaches to handle variability:

    • Use mixed-effects models to account for within-fly and between-fly variability

    • Apply appropriate transformations for non-normally distributed data

    • Report effect sizes alongside p-values

  • Control experiments: Include recordings from:

    • Known ligands for other GRs as positive controls

    • Vehicle solutions as negative controls

    • Gr22b mutant flies to confirm specificity

  • Complementary approaches: Validate electrophysiological findings with:

    • Calcium imaging

    • Behavioral assays

    • Molecular readouts of neuronal activation

By implementing these approaches, researchers can better address discrepancies and increase reproducibility in electrophysiological studies of Gr22b-expressing neurons.

What analytical frameworks should be used when studying potential heteromeric interactions between Gr22b and other gustatory receptors?

Analyzing heteromeric interactions between Gr22b and other GRs requires sophisticated analytical frameworks:

  • Co-expression analysis matrix:

    Receptor CombinationFunctional ResponseMembrane LocalizationPhysical Interaction
    Gr22b alone[Results][Results]N/A
    Gr22b + Gr22d[Results][Results][Results]
    Gr22b + Gr66a[Results][Results][Results]
    Gr22b + multiple GRs[Results][Results][Results]
  • Quantitative interaction models:

    • Apply statistical models that can distinguish between additive, synergistic, or antagonistic effects when multiple receptors are co-expressed

    • Use dose-response curves to characterize how receptor combinations affect sensitivity and dynamic range

  • Biophysical approaches to analyze interactions:

    • FRET/BRET analysis with distance calculations between subunits

    • Single-molecule imaging to determine stoichiometry

    • Computational modeling of potential interaction interfaces

  • Mutagenesis-based mapping:

    • Systematic alanine scanning to identify critical residues for interaction

    • Domain swapping between related GRs to map interaction domains

    • Analysis of natural variants to identify correlation between sequence and functional differences

  • Data integration framework:

    • Combine data from multiple experimental approaches (electrophysiology, imaging, behavioral assays)

    • Develop predictive models of receptor interactions based on sequence homology and functional data

    • Use machine learning approaches to identify patterns in complex datasets

Similar approaches have been used to demonstrate that GR8a, GR66a, and GR98b function together in detecting L-canavanine, showing that three GRs collaborate to produce a functional receptor .

What are the major technical challenges in expressing and purifying functional recombinant Gr22b protein?

Expressing and purifying functional GR proteins, including Gr22b, presents several significant challenges:

  • Low native expression levels: GR genes typically have exceedingly low expression levels, with no expressed sequence tags identified for many GR transcripts . This suggests intrinsic difficulties in achieving high expression.

  • Membrane protein complexity: As transmembrane proteins, GRs are difficult to express and purify while maintaining their native conformation.

  • Multisubunit complexes: Functional GR receptors likely require multiple subunits. For example, L-canavanine detection requires three GRs functioning together . Expressing Gr22b alone may not yield functional protein.

  • Expression system considerations:

    Expression SystemAdvantagesLimitationsRecommendations
    E. coliHigh yield, low costLacks post-translational modifications, inclusion bodies commonUse fusion partners (MBP, SUMO); solubilization optimization
    Insect cellsMore native environmentModerate yield, higher costBaculovirus expression system; co-expression of chaperones
    Mammalian cellsPost-translational modificationsLower yield, highest costHEK293 cells; inducible expression systems
    Cell-free systemsMembrane protein-friendlyScale limitationsSupplement with lipids/detergents
  • Purification challenges:

    • Detergent selection critical for extraction while maintaining function

    • Potential requirement for lipid reconstitution

    • Protein instability during purification processes

    • Difficulty obtaining sufficient quantities for structural studies

  • Verification of functionality: Confirming that purified protein retains native function is challenging without established ligand-binding assays.

Solutions include using insect cell-based expression systems with optimized codon usage, co-expression of multiple GR subunits, testing various detergents and stabilizing agents, and developing robust functional assays to verify activity throughout purification.

How can researchers effectively distinguish between Gr22b-specific effects and those mediated by other co-expressed gustatory receptors?

Distinguishing Gr22b-specific effects from those of other GRs requires careful experimental design:

  • Genetic approaches:

    • Generate precise Gr22b mutants using CRISPR-Cas9 while leaving other GRs intact

    • Create rescue constructs with wild-type Gr22b to confirm phenotype specificity

    • Use RNAi with validated specificity for Gr22b knockdown

  • Single-cell analysis:

    • Perform single-cell RNA-seq on GRNs to identify specific co-expression patterns

    • Use single-cell electrophysiology or calcium imaging to correlate receptor expression with functional responses

    • Apply genetic intersectional approaches to manipulate only neurons that express Gr22b and not other related GRs

  • Heterologous expression:

    • Express Gr22b alone or in combination with other GRs in non-native cells (e.g., S2 cells)

    • Perform systematic subtractive analysis by removing individual components from a functional receptor complex

    • Create chimeric receptors to map functional domains

  • Pharmacological approaches:

    • Develop Gr22b-specific agonists/antagonists through high-throughput screening

    • Use dose-response relationships to differentiate receptor contributions

    • Apply competition assays with known ligands for other GRs

  • Temporal control:

    • Use temperature-sensitive or optogenetic tools to acutely manipulate Gr22b function

    • Analyze immediate versus long-term effects to distinguish direct from compensatory mechanisms

Similar approaches have been successful in delineating the specific roles of GR8a, GR66a, and GR98b in L-canavanine detection , providing a methodological framework for Gr22b studies.

What are the best approaches for analyzing Gr22b evolution and conservation across Drosophila species?

To analyze Gr22b evolution and conservation across Drosophila species, researchers should employ these approaches:

  • Comparative genomics framework:

    • Identify Gr22b orthologs across Drosophila species using reciprocal BLAST searches

    • Analyze synteny to confirm orthologous relationships, particularly important given that GRs often occur in clusters

    • Examine gene structure conservation (exon-intron boundaries, regulatory regions)

  • Sequence analysis methods:

    • Multiple sequence alignment focusing on the conserved C-terminal signature motif in the seventh transmembrane domain

    • Calculate evolutionary rates (dN/dS) to identify signatures of selection

    • Map conservation onto predicted protein structure models

  • Functional conservation testing:

    • Cross-species rescue experiments (Can Gr22b from one species rescue phenotypes in another?)

    • Heterologous expression of Gr22b from different species to compare ligand responses

    • Chimeric receptor studies to map functionally conserved domains

  • Ecological correlation analysis:

    • Connect sequence divergence with ecological specialization

    • Correlate Gr22b evolution with host plant preferences across species

    • Analyze whether Gr22b evolution correlates with exposure to specific toxins or beneficial compounds

  • Data visualization techniques:

    • Phylogenetic trees highlighting Gr22b evolution in context of species divergence

    • Heat maps of sequence conservation across functional domains

    • Network analysis of co-evolving GR genes

A comprehensive evolutionary analysis would help reveal whether Gr22b has a conserved function across Drosophila species or has undergone adaptive evolution related to ecological specialization in different species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.