Recombinant Drosophila melanogaster Putative gustatory receptor 22c (Gr22c)

Shipped with Ice Packs
In Stock

Description

Functional and Evolutionary Insights

Gr22c is part of the Gr22a clade, a cluster of six paralogous genes on chromosome 2L involved in bitter compound detection . Key findings:

  • Pseudogenization: Gr22c is pseudogenized in D. sechellia (a specialist on toxic noni fruits) and lost in D. erecta, suggesting evolutionary adaptation to ecological niches .

  • Expression: Gr22c is expressed in bitter-sensing gustatory receptor neurons (GRNs) , though its specific ligand remains uncharacterized.

  • Selective Sweeps: Gr22b and Gr22d (paralogs in the same clade) show rapid non-synonymous substitutions in D. sechellia, indicating positive selection .

Applications in Research

Recombinant Gr22c is utilized for:

  • Ligand-Binding Assays: To identify bitter compounds or toxins via in vitro assays .

  • Antibody Production: Rabbit polyclonal antibodies against Gr22c enable Western blot and ELISA applications .

  • Evolutionary Studies: Comparative genomics of chemosensory adaptation in Drosophila species .

Comparative Analysis of Gr22c and Related Receptors

ReceptorFunctionExpression SystemEvolutionary Status
Gr22cPutative bitter receptor (uncharacterized ligand)E. coli, mammalian cellsPseudogenized in D. sechellia
Gr66aBroadly tuned bitter receptorGRNsConserved across Drosophila
Gr8aL-canavanine detectionEctopic GRNsSpecialized in toxin resistance

Future Directions

  • Ligand Identification: High-throughput screening to decode Gr22c’s role in bitter sensing.

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve its transmembrane topology.

  • Ecological Relevance: Field studies linking Gr22c polymorphisms to host-plant specialization.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on your purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
Gr22c; CG31929; Putative gustatory receptor 22c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr22c
Target Protein Sequence
MFASRSDLQSRLCWIILKATLYSSWFLGVFPYRFDSRNGQLKRSRFLLFYGLILNFFLLL KMVCSGGQKLGIPEAFARNSVLENTHYTTGMLAVFSCVVIHFLNFWGSTRVQDLANELLV LEYQQFASLNETKCPKFNSFVIQKWLSVIGLLLSYLSIAYGLPGNNFSVEMVLINSLVQF SFNCNIMHYYIGVLLIYRYLWLINGQLLEMVTNLKLDCSVDSSRIRKYLSLYRRLLELKG YMVATYEYHMTLVLTTGLASNFLAIYSWIVLDISMNINFIYLLIFPLFLLVNVWNLWLSI AASDLAENAGKSTQTVLKLFADLEVKDIELERSVNEFALLCGHCQFNFHVCGLFTINYKM GFQMIITSFLYLIYMIQFDFMNL
Uniprot No.

Target Background

Function
This protein is a probable gustatory receptor that mediates acceptance or avoidance behavior in Drosophila melanogaster, depending on its substrates.
Database Links

KEGG: dme:Dmel_CG31929

STRING: 7227.FBpp0077566

UniGene: Dm.26375

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr22e subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Taste bristles in the foreleg and labial palps.

Q&A

What is the basic structure and function of Drosophila melanogaster Gr22c?

Drosophila melanogaster Putative gustatory receptor 22c (Gr22c) is a 383-amino acid transmembrane protein belonging to the gustatory receptor (GR) family. This protein is characterized by a seven-transmembrane domain structure, with a particularly conserved signature motif in the putative seventh transmembrane domain at its C-terminus . Like other members of the GR family, Gr22c is believed to function in taste reception, specifically detecting chemical compounds in the fly's environment .

The amino acid sequence of Gr22c reveals particular structural features that are consistent with its function as a chemosensory receptor, including hydrophobic regions that facilitate membrane integration. The full amino acid sequence is:

MFASRSDLQSRLCWIILKATLYSSWFLGVFPYRFDSRNGQLKRSRFLLFYGLILNFFLLLKMVCSGGQKLGIPEAFARNSVLENTHYTTGMLAVFSCVVIHFLNFWGSTRVQDLANELLVLEYQQFASLNETKCPKFNSFVIQKWLSVIGLLLSYLSIAYGLPGNNFSVEMVLINSLVQFSFNCNIMHYYIGVLLIYRYLWLINGQLLEMVTNLKLDCSVDSSRIRKYLSLYRRLLELKGYMVATYEYHMTLVLTTGLASNFLAIYSWIVLDISMNINFIYLLIFPLFLLVNVWNLWLSIASDLAENAGKSTQTVLKLFADLEVKDIELERSVNEFALLCGHCQFNFHVCGLFTINYKMGFQMIITSFLYLIYMIQFDFMNL

When investigating this receptor, researchers should consider both its structural properties and putative functional role within the broader context of insect chemosensation.

What expression systems are most suitable for producing recombinant Gr22c protein?

  • Bacterial expression (E. coli):

    • Advantages: Cost-effective, high yield, well-established protocols

    • Limitations: Potential improper folding of transmembrane proteins, lack of post-translational modifications

    • Methodology: Expression is typically achieved using vectors containing strong promoters (T7, tac) with the Gr22c sequence fused to an N-terminal His-tag for purification

  • Insect cell expression (Sf9, S2 cells):

    • Advantages: More appropriate post-translational modifications, better folding of insect proteins

    • Methodology: Baculovirus expression systems with optimized signal sequences

  • Yeast expression (Pichia pastoris):

    • Advantages: Eukaryotic processing, high-density culture capabilities

    • Methodology: Integration of expression cassettes into the yeast genome

Selection of the appropriate expression system should be guided by downstream applications. For structural studies requiring proper folding and functionality, insect cell systems might be preferable despite lower yields. For applications where large quantities are needed and native folding is less critical, bacterial systems offer practical advantages, as evidenced by commercially available Gr22c expressed in E. coli .

How should recombinant Gr22c protein be reconstituted and stored for maximum stability?

Proper reconstitution and storage of recombinant Gr22c protein are critical for maintaining its structural integrity and functional properties. Based on established protocols for this protein, researchers should follow these methodological approaches:

Reconstitution procedure:

  • Briefly centrifuge the vial containing lyophilized protein before opening to collect the material at the bottom

  • Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being standard practice for many laboratories) to stabilize protein structure during freezing

  • Gently mix until completely dissolved, avoiding vigorous vortexing that might denature the protein

Storage conditions:

  • For long-term storage: Aliquot the reconstituted protein and store at -20°C or preferably -80°C to prevent repeated freeze-thaw cycles

  • For working solutions: Store at 4°C for no longer than one week

  • Avoid repeated freeze-thaw cycles, as they significantly reduce protein stability

Stability considerations:
The presence of 6% trehalose in the storage buffer (Tris/PBS-based, pH 8.0) is specifically designed to enhance protein stability during freeze-drying and reconstitution . Trehalose acts as a lyoprotectant by stabilizing protein structure through preferential hydration and hydrogen bonding.

When planning experiments, researchers should prepare an appropriate number of single-use aliquots based on the expected frequency of experiments to minimize freeze-thaw cycles and maintain protein integrity.

What methods are most effective for studying Gr22c receptor function in vivo versus in vitro?

Investigating Gr22c receptor function requires different methodological approaches depending on whether the research is conducted in vivo or in vitro. Each approach offers unique insights into receptor biology:

In vivo methods:

  • GAL4-UAS expression system in Drosophila:

    • Methodology: Generating transgenic flies with a Gr22c promoter driving GAL4 expression (Gr22c-GAL4) and crossing with UAS-GFP lines allows visualization of Gr22c expression patterns

    • Application: This method has successfully identified expression patterns in specific gustatory sensilla across taste organs, confirming that Gr22c is expressed in specific chemosensory neurons

    • Data analysis: Confocal microscopy combined with antibody staining (anti-Elav for neurons, anti-β-Gal for Gr22c-expressing cells) can determine cellular specificity

  • Behavioral assays:

    • Proboscis extension response (PER) tests with wild-type versus Gr22c mutant flies

    • Two-choice feeding assays to evaluate taste preferences

    • Data analysis should include statistical methods like ANOVA to evaluate significant differences in behavioral responses

In vitro methods:

  • Heterologous expression systems:

    • Xenopus oocytes with two-electrode voltage-clamp recording

    • HEK293 cells with calcium imaging or patch-clamp recordings

    • Experimental design should include positive controls with known ligands for related receptors

  • Receptor-ligand binding assays:

    • Using purified recombinant Gr22c protein incorporated into lipid bilayers

    • Fluorescence-based or radioligand binding assays to identify potential ligands

    • Data analysis should employ Scatchard plots or Hill plots to determine binding affinity and cooperativity

  • Structural studies:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Nuclear magnetic resonance (NMR) or X-ray crystallography for detailed structural information

When designing these studies, researchers should consider that in vivo approaches better reflect physiological context but offer less molecular detail, while in vitro approaches provide precise molecular insights but may not recapitulate the native cellular environment of the receptor.

How does Gr22c expression pattern compare with other gustatory receptors in Drosophila, and what are the implications for functional specialization?

Spatial expression patterns:
Most GR genes, including Gr22c, exhibit highly restricted expression patterns, typically in only 1-4% of gustatory sensilla and in spatially confined regions . This contrasts with a few GR genes that show broader expression in approximately 20% of sensilla distributed throughout the fly . This restricted expression pattern suggests functional specialization of Gr22c for detecting specific tastants rather than serving as a broadly tuned receptor.

The expression of Gr22c in specific gustatory neurons is consistent with the organization of the gustatory system where:

  • Individual sensilla contain multiple neurons (typically 2-4 gustatory neurons plus one mechanosensory neuron)

  • Each neuron expresses a subset of gustatory receptors

  • No more than one GR-expressing cell is observed per sensillum for Gr22c

Anatomical distribution:
GR family members, including Gr22c, are expressed across multiple gustatory organs:

  • Labellum (primary taste organ on the proboscis)

  • Cibarial organs (pharyngeal taste organs)

  • Tarsal segments of legs

  • Terminal organ in larvae

This distribution allows for taste detection at multiple points during feeding behavior, from initial food contact with the legs to ingestion.

Developmental considerations:
Some GR genes are expressed in both larvae and adults, while others show stage-specific expression. Research should examine whether Gr22c shows developmental regulation and how this correlates with changing ecological needs during the Drosophila life cycle.

Implications for functional specialization:
The highly specific expression pattern of Gr22c suggests a specialized role in detecting particular chemical compounds. The segregation of different GR genes into distinct neurons supports a labeled-line model of taste coding, where each taste quality is detected by dedicated sensory neurons. Researchers investigating Gr22c function should design experiments to identify its specific ligands and sensory role within this framework.

What challenges exist in determining the natural ligands for Gr22c, and how can these be overcome?

Identifying the natural ligands for gustatory receptors like Gr22c presents significant methodological challenges that require sophisticated experimental approaches:

Key challenges:

  • Receptor complexity and diversity:

    • The GR family shows extreme sequence divergence (7-50% identity) , making prediction of ligand specificity difficult based on sequence alone

    • Unlike olfactory receptors, gustatory receptors likely function as heteromultimeric complexes, requiring correct partner subunits for function

  • Low expression levels:

    • GR genes typically exhibit exceptionally low expression levels, as evidenced by the absence of expressed sequence tags for the 43 GR transcripts initially identified

    • This hampers protein purification and traditional binding assays

  • Functional reconstitution:

    • Transmembrane proteins like Gr22c are difficult to functionally reconstitute in artificial systems

    • The correct membrane environment and associated proteins may be necessary for proper function

Methodological solutions:

  • Genetic screening approaches:

    • Generate Gr22c mutant flies using CRISPR/Cas9 to create loss-of-function phenotypes

    • Develop high-throughput behavioral assays to screen diverse tastants, comparing wild-type versus mutant responses

    • Design rescue experiments with the recombinant Gr22c protein to confirm specificity

  • Heterologous expression systems:

    • Express Gr22c together with other potentially interacting GR subunits

    • Utilize optimized expression systems with inducible promoters to overcome low expression issues

    • Implement reporter systems (calcium indicators, voltage sensors) to detect receptor activation

  • Advanced biochemical approaches:

    • Develop photoaffinity labeling compounds based on candidate ligands

    • Employ surface plasmon resonance (SPR) with immobilized recombinant Gr22c

    • Create chimeric receptors with better-characterized receptors to facilitate expression and functional analysis

  • Computational approaches:

    • Utilize molecular docking simulations based on predicted Gr22c structure

    • Apply machine learning algorithms trained on known ligand-receptor pairs from other GRs

    • Analyze the Gr22c sequence for structural motifs associated with specific ligand binding properties

By combining these approaches, researchers can systematically narrow down potential ligands and establish the functional role of Gr22c in the Drosophila gustatory system.

How do recent findings on recombination in Drosophila melanogaster impact experimental design for genetic studies of Gr22c?

Understanding the complex recombination landscape in Drosophila melanogaster is crucial for designing genetically robust experiments involving Gr22c. Recent research has revealed several important considerations that directly impact experimental strategies:

Key recombination factors affecting experimental design:

  • Genomic position effects:
    The Gr22c gene location should be considered in the context of recombination rate variation across the genome. Drosophila melanogaster exhibits significant variation in recombination rates, with suppressed recombination near centromeres and telomeres . Research indicates that recombination suppression decay differs for each of the four cosmopolitan inversions, with strong dependence on proximity to the centromere . Experimental design should account for these position effects when:

    • Planning genetic crosses involving Gr22c

    • Interpreting linkage disequilibrium patterns around Gr22c

    • Designing transgene insertion strategies

  • Impact of chromosomal inversions:
    Chromosomal inversions suppress recombination in heterozygotes, with complex decay patterns extending beyond inversion breakpoints . Studies have shown that recombination suppression is not uniform along inverted regions, with counterintuitive findings of greater than expected recombination in centromeric regions for proximally placed inversions . When working with Gr22c:

    • Verify the chromosomal arrangement in experimental fly stocks

    • Consider potential linkage effects if Gr22c is located near inversion breakpoints

    • Account for population-specific inversion polymorphisms when using natural populations

  • Sex-specific recombination patterns:
    Drosophila melanogaster exhibits no meiotic recombination in males, and female recombination rates show individual variation . This creates important considerations for:

    • Designing crossing schemes (using appropriate sex as the recombining parent)

    • Calculating expected recombination frequencies

    • Interpreting results from different genetic backgrounds

  • Gene conversion considerations:
    Recent research distinguishes between crossing over (CO) and gene conversion (GC) as separate outcomes of meiotic recombination . This distinction affects:

    • Interpretation of fine-scale genetic mapping data

    • Analysis of allelic variation at the Gr22c locus

    • Design of markers for tracking Gr22c variants

Methodological recommendations:

  • Characterize the recombination landscape surrounding Gr22c in your specific fly stocks

  • Use balancer chromosomes when appropriate to prevent recombination

  • Include control crosses to establish baseline recombination rates for your experimental system

  • Consider using site-specific integration systems (e.g., PhiC31) for transgene experiments to eliminate position effects

  • When studying natural variation, account for population structure and inversion polymorphisms that might affect Gr22c

By incorporating these considerations into experimental design, researchers can avoid confounding effects from recombination variation and generate more reliable genetic data on Gr22c function and evolution.

What are the potential interactions between Gr22c and other gustatory receptors, and how might these be experimentally investigated?

The gustatory receptor family in Drosophila melanogaster likely functions through complex interactions between multiple receptor subunits. Investigating these interactions for Gr22c requires sophisticated experimental approaches that can detect and characterize protein-protein interactions in this challenging receptor system.

Theoretical basis for receptor interactions:

The extreme divergence within the GR family (7-50% sequence identity) suggests functional diversification, but the consistent conservation of the signature motif in the seventh transmembrane domain indicates that this region may mediate interactions between GR subunits. Evidence from other chemosensory systems suggests that gustatory receptors likely function as heteromultimeric complexes rather than as monomers.

Methodological approaches to investigate Gr22c interactions:

  • Co-expression analysis:

    • Perform RNA-seq on single gustatory sensory neurons to identify GR genes co-expressed with Gr22c

    • Use dual-reporter systems (e.g., Gr22c-GAL4 driving UAS-RFP crossed with other GR-GFP lines) to visually confirm co-expression

    • Data analysis should include correlation statistics and clustering to identify consistently co-expressed receptors

  • Protein-protein interaction assays:

    • Conduct split-ubiquitin or split-GFP assays in heterologous expression systems

    • Perform co-immunoprecipitation using tagged versions of Gr22c and candidate interacting partners

    • Apply FRET (Förster Resonance Energy Transfer) or BiFC (Bimolecular Fluorescence Complementation) to detect direct interactions

    • Utilize the recombinant Gr22c protein for in vitro binding assays with other purified GRs

  • Functional complementation studies:

    • Generate combinatorial knockouts of Gr22c and other GR genes

    • Perform rescue experiments with various combinations of receptors

    • Evaluate functional responses through electrophysiological recordings or calcium imaging

    • Compare behavioral responses between single and double mutants

  • Structural biology approaches:

    • Conduct molecular modeling of Gr22c based on the known amino acid sequence

    • Perform cross-linking studies followed by mass spectrometry to identify interaction interfaces

    • Utilize cryo-electron microscopy of reconstituted receptor complexes

Experimental design considerations:

When investigating Gr22c interactions, researchers should design experiments with appropriate controls:

  • Include positive controls using known interacting proteins (e.g., Orco with olfactory receptors)

  • Test interactions with non-GR membrane proteins as negative controls

  • Validate results using multiple independent methods

  • Consider dose-dependency of interactions by testing various expression ratios

Interaction Detection MethodAdvantagesLimitationsAppropriate Controls
Co-immunoprecipitationDetects native complexesMay detect indirect interactionsIgG control; unrelated membrane protein
FRET/BiFCDetects direct interactions in living cellsRequires protein taggingPositive control pairs; unrelated protein pairs
Split-ubiquitinSuitable for membrane proteinsPotential false positivesKnown interacting pairs; structurally similar non-interacting pairs
Cross-linking/MSIdentifies interaction interfacesComplex data analysisCross-linking without specific antibody pulldown

Understanding the interaction partners of Gr22c will provide critical insights into how this receptor functions within the larger gustatory sensory system and may reveal mechanisms of ligand specificity and signal transduction.

What are the critical quality control parameters for recombinant Gr22c protein production and how should they be assessed?

Ensuring the quality and functionality of recombinant Gr22c protein is essential for obtaining reliable experimental results. Researchers should implement comprehensive quality control procedures throughout the production process:

Critical quality control parameters:

  • Protein purity:

    • Expected standard: Greater than 90% as determined by SDS-PAGE

    • Assessment method: Densitometric analysis of Coomassie-stained gels

    • Advanced verification: Mass spectrometry to confirm absence of contaminants and proper sequence

  • Protein identity confirmation:

    • Western blot analysis using anti-His tag antibodies (for N-terminally His-tagged Gr22c)

    • Mass spectrometry peptide mapping to confirm sequence coverage

    • N-terminal sequencing to verify correct translation initiation

  • Protein folding and structure:

    • Circular dichroism (CD) spectroscopy to assess secondary structure elements

    • Fluorescence spectroscopy to evaluate tertiary structure (intrinsic tryptophan fluorescence)

    • Thermal shift assays to determine protein stability

    • Size-exclusion chromatography to assess aggregation state

  • Functional validation:

    • Ligand binding assays (if known ligands are available)

    • Reconstitution into proteoliposomes and functional testing

    • Surface plasmon resonance to assess binding kinetics

Recommended quality control protocol:

StageTestsAcceptance CriteriaTroubleshooting
Post-expressionSDS-PAGE; Western blotClear band at expected MW (~42kDa with His-tag); immunoreactivity with anti-His tagOptimize induction conditions; verify expression vector sequence
Post-purificationSDS-PAGE; protein concentration>90% purity ; concentration ≥0.5mg/mlModify purification protocol; add additional purification steps
Pre-storageEndotoxin test; sterility checkEndotoxin <1EU/mg; no microbial growthFilter sterilization; additional purification steps
Post-reconstitutionDynamic light scattering; size exclusionMonodisperse population; minimal aggregationAdjust buffer conditions; optimize reconstitution protocol

Documentation requirements:

For each batch of recombinant Gr22c protein produced, researchers should maintain comprehensive documentation including:

  • Expression conditions (temperature, induction time, cell density)

  • Purification protocol details (column types, buffer compositions, elution conditions)

  • Quality control test results with raw data

  • Storage conditions and date of preparation

  • Batch-specific activity data if functional assays are performed

Implementing this rigorous quality control regimen will ensure that experimental results obtained with recombinant Gr22c protein are reliable and reproducible across different research groups and applications.

What structural and functional differences exist between recombinant Gr22c and the natively expressed receptor, and how might these impact experimental results?

Recombinant protein production can introduce several structural and functional differences compared to natively expressed proteins. Understanding these differences is crucial for correctly interpreting experimental results with recombinant Gr22c:

Key structural differences:

  • Protein modifications:

    • Recombinant Gr22c typically includes an N-terminal His-tag for purification purposes

    • Native Gr22c lacks this tag, which may affect protein folding or interactions

    • Experimental approach: Compare tagged versus untagged versions using cleavable tags to assess impact

  • Post-translational modifications:

    • E. coli expression systems lack eukaryotic protein modification machinery

    • Native Gr22c in Drosophila may undergo glycosylation, phosphorylation, or other modifications

    • Experimental approach: Mass spectrometry analysis of native Gr22c to identify modifications absent in recombinant protein

  • Protein folding:

    • Membrane proteins often fold differently in bacterial systems versus native membranes

    • Recombinant Gr22c may adopt alternative conformations when expressed in E. coli

    • Experimental approach: Compare circular dichroism spectra between native and recombinant protein

Functional implications:

  • Ligand binding properties:

    • Altered protein conformation may change binding pocket geometry

    • Absence of post-translational modifications might affect binding affinity or specificity

    • Experimental approach: Compare dose-response curves between heterologously expressed Gr22c and native neurons

  • Protein-protein interactions:

    • His-tag may interfere with interaction domains

    • Incorrect folding could mask or expose interaction surfaces

    • Experimental approach: Co-immunoprecipitation studies with both recombinant and native protein

  • Membrane integration:

    • Native Gr22c is integrated into neuronal membranes in specific microdomains

    • Recombinant protein may require specific lipid environments for proper function

    • Experimental approach: Test function in different reconstitution systems with varying lipid compositions

Comparison table of native versus recombinant Gr22c:

FeatureNative Gr22cRecombinant Gr22c (E. coli)Potential Impact on Experiments
N-terminal tagAbsentHis-tag present May affect protein folding, interactions, or ligand binding
GlycosylationPotentially presentAbsentCould alter receptor stability or ligand specificity
Membrane environmentNeuronal membraneBacterial membrane or detergent micellesMay affect receptor conformation and function
Associated proteinsCo-expressed with other GRsExpressed in isolationLack of interaction partners may alter function
Expression levelVery low High (mg quantities possible) High expression may cause misfolding or aggregation

Methodological recommendations:

  • Validate recombinant protein function:

    • Compare functional properties with native receptor when possible

    • Use multiple expression systems (bacterial, insect, mammalian) to identify system-specific artifacts

  • Consider native context:

    • Reconstitute recombinant Gr22c with potential interaction partners

    • Use native-like lipid compositions for functional studies

  • Control for tag effects:

    • Include tag removal step when possible

    • Test multiple tag positions (N-terminal, C-terminal, internal) to identify optimal configuration

  • Reporting standards:

    • Explicitly acknowledge limitations of recombinant systems in publications

    • Report detailed methods for protein production and characterization

By systematically addressing these differences, researchers can develop more accurate models of Gr22c function and appropriately contextualize findings obtained with recombinant protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.