Recombinant Drosophila melanogaster Putative gustatory receptor 22d (Gr22d)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Gr22D is a member of the gustatory receptor (Gr) family, which mediates taste perception in Drosophila melanogaster. The recombinant form is produced in E. coli systems, tagged with a hexahistidine (His) sequence for purification, and retains the full-length amino acid sequence (residues 1–387) .

Genetic and Genomic Context

Gr22D is encoded by the Gr22d gene (UniProt ID: P84181, synonyms: CG31930) located in cytogenetic region 39D . Genomic studies reveal that Gr22d resides in a locus with extensive structural variation, including hidden genetic polymorphisms that may influence its expression or function . Notably:

  • Evolutionary Conservation: Gr proteins are highly divergent, but Gr22D shares a conserved 33-amino-acid motif in its seventh transmembrane domain, a hallmark of insect gustatory receptors .

  • Genetic Variability: Structural variant mapping of D. melanogaster genomes identified Gr22d as part of regions with tandem duplications and retroelement insertions, suggesting potential regulatory plasticity .

Research Applications

Recombinant Gr22D is primarily used for:

  • Structural Studies: Analyzing transmembrane topology and ligand-binding domains via SDS-PAGE or crystallography .

  • Antibody Production: Polyclonal antibodies against Gr22D enable detection in Western blot (WB) and ELISA .

  • Functional Assays: Reconstitution in heterologous systems (e.g., Xenopus oocytes) to test ion channel activity or ligand responses .

Future Directions

Critical gaps in Gr22D research include:

  • Ligand Identification: High-throughput screening assays using recombinant Gr22D to identify candidate tastants.

  • In Vivo Role: CRISPR/Cas9 knockout studies to assess its contribution to feeding behavior or toxin avoidance.

  • Structural Resolution: Cryo-EM studies to resolve its tertiary structure and interaction interfaces.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Gr22d; CG31930; Putative gustatory receptor 22d
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr22d
Target Protein Sequence
MFRPRCGLRQKFVYVILKSILYSSWLLGIFPFKYEPKKRRLRRSMWLIPFGVVISSSLLI LMVKQSAEDREHGIMLDVFQRNALLYQISSLMGVVGVVSICTVHLRTLWRSKHLEEIYNG LMLLEAKYFCSNAVECPAFDGYVIQKGVVIVVGLLAPWMVHFGMPDSKLPVLNVLVVSMV KLGTLLLALHYHLGVVIIYRFVWLINRELLSLVCSLRGNHKGSSSRVRFLLKLYNKLVNL YSKLADCYDCQTVLMMAIFLAANIIVCFYMIVYRISLSKMSFFVMLIMFPLAIANNFMDF WLSMKVCDLLQKTGRQTSMILKLFNDIENMDKDLEISISDFALYCSHRRFKFLHCGLFHV NREMGFKMFVASVLYLLYLVQFDYMNL
Uniprot No.

Target Background

Function

Probable Function: This protein is a putative gustatory receptor likely mediating acceptance or avoidance behavior in Drosophila melanogaster, depending on the specific substrates encountered.

Database Links
Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr22e subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in neurons of the dorsal pharyngeal sense organs of larvae.

Q&A

How should recombinant Gr22d protein be stored and handled for experimental use?

Proper storage and handling of recombinant Gr22d protein is crucial for maintaining its integrity and functionality in experimental settings. The protein is commonly supplied as a lyophilized powder and should be stored at -20°C/-80°C upon receipt. For optimal stability:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being standard) for long-term storage

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

The protein is typically stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability .

What is the relationship between Gr22d and other gustatory receptors in Drosophila?

What applications is recombinant Gr22d protein commonly used for?

Recombinant Gr22d protein is primarily used for:

  • SDS-PAGE analysis: To study protein characteristics, purity (typically >90% as determined by SDS-PAGE), and molecular interactions

  • Structural studies: To understand the transmembrane architecture of gustatory receptors

  • Immunological research: For antibody production and validation

  • Receptor-ligand interaction studies: To investigate binding properties with potential tastants

  • Functional characterization: In conjunction with expression systems to study receptor function

The recombinant protein, with its N-terminal His-tag, facilitates purification and detection in various experimental setups, making it valuable for researchers studying chemosensory mechanisms in Drosophila .

How does Gr22d expression compare between different chemosensory organs in Drosophila?

The expression pattern of gustatory receptors, including Gr22d, varies across different chemosensory organs in Drosophila. Research utilizing GAL4 driver lines has revealed complex spatial organization of GR gene expression:

  • In larvae: GR genes are expressed in the terminal organ (TO), which is a primary site for external taste reception. Specifically, five of seven adult-expressed GR genes show expression in single neurons within the terminal organ. These neurons extend dendrites anteriorly that terminate in the dome-shaped terminal organ structure that interfaces with the environment .

  • In adults: GR genes show expression in multiple chemosensory organs:

    • Proboscis: Several GR genes, including some related to Gr22d, are expressed in taste neurons in the labellum

    • Internal mouth organs: Expression is detected in the labral sense organ (LSO)

    • Legs: Some GR genes are expressed in chemosensory cells in the most distal tarsal segments of all legs

    • Antennae: Certain GR genes show expression in 20-30 cells in regions distinct from those expressing olfactory receptor genes

This differential expression pattern suggests specialized roles for gustatory receptors in different sensory contexts, with Gr22d potentially contributing to specific aspects of chemosensation depending on its anatomical location .

What are the neural projection patterns of Gr22d-expressing neurons and their implications for taste perception?

Neurons expressing gustatory receptors, including those in the Gr22d family, exhibit specific projection patterns that provide insights into the neural processing of taste information:

  • Larval projections: Neurons in the terminal organ expressing GR genes project to the subesophageal ganglion (SOG). Different GR-expressing neurons may project to discrete, partially overlapping regions within the SOG, suggesting a potential spatial map for taste quality .

  • Adult projections:

    • Proboscis gustatory neurons: Project to the SOG

    • Antennal GR-expressing neurons: Project to a single, bilaterally symmetric glomerulus (the V glomerulus) in the ventral-most region of the antennal lobe, not to the SOG

The distinct projection patterns imply that:

  • Neurons expressing the same receptor converge on specific brain regions

  • The same chemosensory stimulus may elicit different behavioral outputs depending on which neurons are activated

  • There may be a topographic organization of taste quality in the brain

This neural architecture suggests that Gr22d-expressing neurons likely contribute to specific aspects of taste perception through their unique connectivity patterns .

What methodological approaches can be used to study Gr22d function in vivo?

Several sophisticated methodological approaches can be employed to investigate Gr22d function in vivo:

  • GAL4-UAS system: Using Gr22d promoter-GAL4 constructs paired with UAS-reporter genes (GFP, LacZ) to visualize expression patterns and neural projections. This approach has been successfully employed for other GR genes and can be adapted for Gr22d .

  • Neuroanatomical tracing: Utilizing UAS-nSyb-GFP (neuronal synaptobrevin-GFP fusion) expressed under control of Gr22d promoter to trace projections of Gr22d-expressing neurons to specific brain regions .

  • Functional imaging: Calcium imaging using genetically encoded calcium indicators (GECIs) expressed in Gr22d neurons to monitor neural activity in response to tastants.

  • Optogenetics: Expressing channelrhodopsin or other light-activated channels in Gr22d neurons to artificially activate them and observe behavioral responses.

  • CRISPR-Cas9 gene editing: For precise modification of the Gr22d gene to study structure-function relationships.

  • Electrophysiology: Measuring electrical responses in Gr22d-expressing sensilla to various chemical stimuli to determine ligand specificity.

These approaches can be combined to comprehensively characterize the role of Gr22d in chemosensation and taste perception in Drosophila .

What techniques are available for analyzing protein-protein interactions involving Gr22d?

Researchers have several sophisticated techniques at their disposal to study protein-protein interactions involving recombinant Gr22d:

  • Co-immunoprecipitation (Co-IP): Using the His-tag on recombinant Gr22d to pull down interacting proteins from lysates, followed by mass spectrometry identification. This technique requires properly reconstituted recombinant Gr22d protein in appropriate buffers .

  • Yeast two-hybrid screening: Utilizing Gr22d as bait to identify potential interacting partners from Drosophila cDNA libraries.

  • Bioluminescence resonance energy transfer (BRET): For analyzing interactions in living cells by tagging Gr22d and potential interacting proteins with appropriate donor and acceptor molecules.

  • Proximity ligation assay (PLA): Visualizing protein-protein interactions in situ within fixed tissues or cells.

  • Surface plasmon resonance (SPR): Using purified recombinant Gr22d to quantitatively measure binding kinetics with potential interacting partners.

  • Crosslinking mass spectrometry: Employing chemical crosslinkers to capture transient interactions followed by mass spectrometry analysis.

When using these techniques, researchers must consider the membrane-bound nature of Gr22d, which contains multiple transmembrane domains. Detergent solubilization and proper buffer conditions are critical for maintaining protein structure and function during interaction studies .

What protein expression systems are optimal for producing functional recombinant Gr22d?

The choice of expression system is crucial for obtaining functional recombinant Gr22d protein. Several systems can be considered, each with specific advantages:

For functional studies, insect cell expression systems may offer advantages over the E. coli system currently used for producing the commercially available Gr22d protein .

How can researchers optimize solubilization and purification of Gr22d protein?

Successful solubilization and purification of Gr22d protein requires careful optimization due to its multiple transmembrane domains. A comprehensive approach includes:

  • Detergent screening:

    • Mild detergents (DDM, LMNG, or digitonin) for initial extraction

    • Detergent concentration optimization (typically 1-2% for extraction, 0.1-0.5% for purification)

    • Detergent mixtures may improve extraction efficiency

  • Buffer optimization:

    • Starting with Tris/PBS-based buffer at pH 8.0 as used for commercial Gr22d

    • Including stabilizers like trehalose (6% is used commercially)

    • Testing glycerol additions (5-50%) as recommended for storage

    • Considering lipid addition during purification to maintain native-like environment

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Size exclusion chromatography to separate aggregates

    • Potential ion exchange step for higher purity

  • Quality control:

    • SDS-PAGE to confirm >90% purity as expected

    • Circular dichroism to verify secondary structure

    • Dynamic light scattering to assess homogeneity

  • Storage considerations:

    • Aliquoting to avoid freeze-thaw cycles

    • Addition of glycerol as cryoprotectant

    • Storage at -20°C/-80°C for long-term, 4°C for up to one week

The reconstitution process is critical; researchers should centrifuge the vial briefly before opening and reconstitute in deionized sterile water to 0.1-1.0 mg/mL as recommended for the commercial protein .

What experimental designs are most effective for characterizing Gr22d ligand specificity?

Characterizing the ligand specificity of Gr22d requires multifaceted experimental approaches:

  • Heterologous expression systems:

    • Expression in Xenopus oocytes followed by two-electrode voltage clamp recording

    • Stable transfection in HEK293 or CHO cells for calcium imaging

    • Measurement of response to candidate tastants from different chemical classes

  • In vivo electrophysiology:

    • Single sensillum recordings from Gr22d-expressing sensilla

    • Tip recording from labellar taste sensilla

    • Comparison of responses from wild-type and Gr22d mutant flies

  • Behavioral assays:

    • Two-choice preference tests with Gr22d mutants vs. controls

    • Proboscis extension reflex (PER) assays with targeted stimulation

    • Quantitative feeding assays with potential ligands

  • Molecular docking and structural modeling:

    • Using the known amino acid sequence to predict binding sites

    • In silico screening of potential ligands

    • Structure-activity relationship studies with modified ligands

  • Optical imaging:

    • GCaMP imaging in Gr22d neurons in response to tastant application

    • Comparison across different organs (labellum, legs, internal mouth organs)

What controls and validations are essential when working with recombinant Gr22d?

Rigorous controls and validations are critical for ensuring reliable results when working with recombinant Gr22d:

  • Protein quality controls:

    • SDS-PAGE analysis to confirm size and purity (>90% as specified)

    • Western blot with anti-His antibodies to verify identity

    • Mass spectrometry to confirm sequence integrity

    • Circular dichroism to assess proper folding

  • Functional validation:

    • Binding assays with known gustatory receptor ligands

    • Comparison with other purified gustatory receptors

    • Native PAGE to assess oligomerization state

  • Experimental controls:

    • Empty vector controls for expression studies

    • Heat-denatured protein as negative control

    • Other GR family members as comparison

    • Wild-type vs. Gr22d mutant Drosophila for in vivo studies

  • Antibody validation:

    • Pre-adsorption controls for immunohistochemistry

    • Testing antibody specificity on Gr22d knockout tissues

    • Multiple antibodies targeting different epitopes

  • Reconstitution validation:

    • Functional assays before and after reconstitution

    • Testing different reconstitution conditions

    • Monitoring protein stability over time

Researchers should maintain working aliquots at 4°C for up to one week and avoid repeated freeze-thaw cycles, as recommended for the commercial protein preparation .

How can Gr22d research contribute to broader understanding of insect chemosensation?

Research on Gr22d provides valuable insights into the molecular mechanisms of chemosensation that extend beyond Drosophila:

  • Evolutionary perspectives:

    • Gr22d belongs to the highly divergent GR family with 56+ members showing only 7-50% sequence identity

    • Comparative studies can reveal evolutionary conservation and divergence of taste reception across insect species

    • Analysis of the conserved 33-amino acid signature motif in the seventh transmembrane domain provides insights into functional constraints during evolution

  • Neural circuit organization:

    • Understanding how Gr22d-expressing neurons project to specific brain regions helps decode the principles of chemosensory processing

    • The finding that neurons expressing the same receptor project to specific glomeruli suggests organizational similarities between olfactory and gustatory systems

  • Functional diversity:

    • Gr22d expression in different sensory structures (labellum, internal mouth organs, legs) suggests diverse roles in detecting environmental chemicals

    • The different subtypes of sensilla (papilla, pit, spot, knob) expressing GR genes indicate specialized detection mechanisms

  • Molecular mechanisms:

    • Study of Gr22d structure-function relationships using the recombinant protein can reveal general principles of taste receptor operation

    • Understanding of transduction mechanisms can identify common themes across chemosensory systems

This research contributes to a fundamental understanding of how insects perceive their chemical environment, with potential applications in pest control, ecological studies, and biomimetic sensor development .

What genomic and transcriptomic approaches can enhance Gr22d functional characterization?

Advanced genomic and transcriptomic methodologies offer powerful tools for deeper functional characterization of Gr22d:

  • RNA-Seq analysis:

    • Temporal expression profiling across developmental stages

    • Differential expression analysis under various physiological conditions

    • Co-expression network analysis to identify functional partners

  • Single-cell transcriptomics:

    • Detailed profiling of individual Gr22d-expressing neurons

    • Identification of cell-type specific co-receptors and signaling components

    • Heterogeneity analysis within seemingly similar sensilla types

  • CRISPR-Cas9 genome editing:

    • Generation of precise Gr22d mutations to study structure-function relationships

    • Knock-in of reporter genes at the endogenous locus for expression analysis

    • Creation of conditional knockout models for temporal control

  • ChIP-Seq and ATAC-Seq:

    • Identification of transcription factors regulating Gr22d expression

    • Mapping of regulatory elements controlling tissue-specific expression

    • Chromatin accessibility analysis in different chemosensory organs

  • Ribosome profiling:

    • Assessment of translational efficiency of Gr22d mRNA

    • Identification of potential alternative translation start sites

These approaches can overcome the challenge of low expression levels noted for GR genes, where "expression levels of the GR genes are exceedingly low" and "no expressed sequence tags have been identified for any of the 43 GR transcripts" initially studied .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.