Recombinant Drosophila melanogaster Putative gustatory receptor 22e (Gr22e)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bitter Compound Detection

Gr22e forms heteromeric complexes with other GRs to detect aversive substances:

Table 1: Gr22e-Dependent Receptor Complexes and Ligands

Receptor ComplexLigands DetectedSensilla TypeCitations
GR22e/GR32a/GR66aStrychnine, Chloroquine, DenatoniumS-b, I-a
GR22e/GR9a/GR98aHistamineLabellar S-type
GR22e/GR33aChloroquine (secondary pathway)S-type
  • Key ligands:

    • Strychnine: Detection requires GR22e/GR32a/GR66a; loss of Gr22e abolishes neural response .

    • Chloroquine: Activates GR22e/GR33a complexes, evoking avoidance behavior .

    • Histamine: Sensed via GR22e/GR9a/GR98a in labellar sensilla .

Genetic and Functional Interactions

Gr22e exhibits partial redundancy with Gr59c but has unique roles:

  • Functional overlap: Both Gr22e and Gr59c form complexes with GR32a/GR66a to detect denatonium and berberine .

  • Distinct roles: Only Gr22e enables strychnine detection, highlighting its non-redundant function .

  • Mutant phenotypes:

    • Gr22e mutants show reduced aversion to strychnine (80% loss) and chloroquine (65% loss) .

    • Overexpression in sweet GRNs confers novel responsiveness to bitter ligands .

Research Gaps and Technical Challenges

  • Recombinant production: No commercial recombinant Gr22e is available. Studies rely on ectopic expression in GRNs or heterologous systems (e.g., S2 cells) .

  • Crystallography: Structural data are lacking due to low expression and membrane localization challenges.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery details.
Note: All protein shipments default to standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
Gr22e; CG31936; Gustatory receptor for bitter taste 22e
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr22e
Target Protein Sequence
MFRPSGSGYRQKWTGLTLKGALYGSWILGVFPFAYDSWTRTLRRSKWLIAYGFVLNAAFI LLVVTNDTESETPLRMEVFHRNALAEQINGIHDIQSLSMVSIMLLRSFWKSGDIERTLNE LEDLQHRYFRNYSLEECISFDRFVLYKGFSVVLELVSMLVLELGMSPNYSAQFFIGLGSL CLMLLAVLLGASHFHLAVVFVYRYVWIVNRELLKLVNKMAIGETVESERMDLLLYLYHRL LDLGQRLASIYDYQMVMVMVSFLIANVLGIYFFIIYSISLNKSLDFKILVFVQALVINML DFWLNVEICELAERTGRQTSTILKLFNDIENIDEKLERSITDFALFCSHRRLRFHHCGLF YVNYEMGFRMAITSFLYLLFLIQFDYWNL
Uniprot No.

Target Background

Function
Gustatory receptor 22e (Gr22e) is a receptor in Drosophila melanogaster that mediates acceptance or avoidance behavior based on its substrates. It is believed to play a role in sensing bitter taste, as it is expressed in neurons that respond to bitter compounds, which are typically associated with avoidance behavior.
Database Links

KEGG: dme:Dmel_CG31936

STRING: 7227.FBpp0077556

UniGene: Dm.26374

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr22e subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Taste bristles on the labial palp, labral and cibarial sense organs, chemosensory bristles on the leg and anterior wing margin. In larvae, is expressed in neurons of the terminal external chemosensory organ and in the dorsal pharyngeal sense organ. Neuron

Q&A

What is Gr22e and what is its basic function in Drosophila melanogaster?

Gr22e is a gustatory receptor that mediates acceptance or avoidance behaviors in Drosophila melanogaster, depending on the chemical substrates it detects. It is primarily involved in sensing bitter taste as it is expressed in neurons that mediate sensitivity to bitter compounds, which generally function as avoidance-type taste neurons . Gr22e belongs to the insect chemoreceptor superfamily and is one of 60 gustatory receptor genes that encode 68 proteins through alternative splicing in Drosophila . The receptor's primary function appears to be in the detection of aversive compounds, contributing to the fly's ability to avoid potentially harmful substances in its environment.

In which sensory organs and neurons is Gr22e expressed?

Gr22e expression has been documented in several pharyngeal and external sensory organs. According to expression pattern analyses using Gr-GAL4 transgenes, Gr22e is expressed in:

  • One neuron in the Dorsal Pharyngeal Sensilla (DPS)

  • Two neurons in the Dorsal Pharyngeal Sense Organ (DPSO)

  • S-b sensilla in the labellum

The following table shows the expression pattern of Gr22e along with other gustatory receptors in pharyngeal organs:

Pharyngeal organsGr22e-GAL4
DPS1
VPS-
PPS-
DPSO2

Numbers indicate the maximum number (DPS) or range (VPS and PPS) of neurons labeled on one side of the animal by the indicated Gr-GAL4 driver.

What bitter compounds are detected by Gr22e-containing receptor complexes?

Gr22e does not function alone but forms heteromeric complexes with other gustatory receptors, primarily GR32a and GR66a. These complexes are responsive to several bitter compounds:

  • Lobeline (LOB)

  • Berberine (BER)

  • Denatonium (DEN)

  • Strychnine (STR)

  • Sucrose octaacetate (SOA)

Research has demonstrated that the GR22e/GR32a/GR66a complex is particularly important for the detection of strychnine, in addition to the other bitter compounds listed above . When this complex is misexpressed in sweet-sensing neurons using the Gr64f-GAL4 driver, it confers sensitivity to LOB, BER, DEN, and STR, indicating that these three receptors represent the minimal complex necessary for detecting these bitter compounds .

How do Gr22e mutations affect behavioral responses to bitter compounds?

Mutations in the Gr22e gene result in reduced behavioral and neuronal responses to specific bitter compounds. Gr22e mutant flies show decreased avoidance of:

  • Lobeline (LOB)

  • Berberine (BER)

  • Denatonium (DEN)

  • Strychnine (STR)

  • Sucrose octaacetate (SOA)

The behavioral defects in Gr22e mutants can be rescued by expressing wild-type Gr22e in bitter gustatory receptor neurons (GRNs) using the Gr33a-GAL4 driver . Interestingly, double mutants of Gr22e and Gr59c show more severe defects in LOB, BER, and DEN avoidance compared to either single mutant, suggesting potential functional redundancy or complementary roles between these receptors .

What genetic approaches can be used to study Gr22e function?

Several genetic approaches have proven effective for studying Gr22e function:

  • Gene knockout/mutation: Creating Gr22e mutants through molecular techniques to assess loss-of-function phenotypes.

  • GAL4/UAS system: Using Gr22e-GAL4 drivers to express reporter genes like GFP to visualize expression patterns, or to express functional proteins for rescue or misexpression experiments .

  • Rescue experiments: Expressing wild-type Gr22e in Gr22e mutant backgrounds using drivers like Gr33a-GAL4 to confirm phenotype specificity .

  • Misexpression studies: Expressing Gr22e in neurons that normally don't express it (e.g., sweet GRNs using Gr64f-GAL4) to confer novel taste responses .

  • Double mutant analysis: Creating Gr22e,Gr59c double mutants to investigate potential redundancy or interaction between gustatory receptors .

The GAL4/UAS system has been particularly valuable since traditional in situ hybridization with Gr genes has been largely unsuccessful due to their low expression levels .

How can calcium imaging be used to analyze Gr22e-mediated responses?

Calcium imaging using genetically encoded calcium indicators like GCaMP5 can be employed to visualize and quantify neuronal responses mediated by Gr22e. Researchers can express GCaMP5 under the control of a Gr22e-GAL4 driver to specifically monitor calcium influx in Gr22e-expressing neurons upon stimulation with bitter compounds.

According to the search results: "Extremely weak fluorescent changes were detected in the C1 neuron labeled by Gr22e > GCaMP5 in response to 10 mM caffeine (n = 6)" . This approach allows for real-time monitoring of neuronal activity in response to specific tastants.

For statistical analysis of such data, researchers typically use:

  • Kruskal-Wallis tests for multiple comparisons across genotypes

  • Mann-Whitney U tests for pair-wise comparisons

  • Data presentation in box plots, with middle lines representing medians, '+' symbols indicating means, and box boundaries showing 25%/75% percentiles

How does Gr22e interact with other gustatory receptors to form functional complexes?

Gr22e functions in heteromeric complexes with other gustatory receptors, particularly GR32a and GR66a. STRING database analysis indicates strong functional partnerships between these proteins, with confidence scores of:

Protein partnerConfidence score
Gr32a0.893
Gr66a0.864
Gr59c0.843
Gr33a(score not fully shown)

These interactions are crucial for proper receptor function . Research has demonstrated that:

  • GR22e/GR32a/GR66a forms a functional complex that detects LOB, BER, DEN, and STR

  • This complex represents the minimal components necessary for these responses

  • When co-expressed in sweet GRNs lacking the Gr64 cluster (Gr64af), the complex confers sensitivity to these bitter compounds

The formation of different receptor complexes with varying compositions enables diversification of taste coding and broadens the behavioral repertoire of flies in response to their chemical environment.

What is the relationship between Gr22e and Gr59c in bitter compound detection?

Gr22e and Gr59c exhibit an interesting relationship in bitter compound detection:

When Gr22e is expressed in a Gr59c mutant background or Gr59c is expressed in a Gr22e mutant background, the flies show nearly identical responses to LOB, BER, and DEN. This indicates functional redundancy between these receptors for most bitter compounds, with the notable exception of STR detection, which requires specifically Gr22e .

How do experimental design considerations affect Gr22e functional analysis?

Several experimental design considerations are crucial for robust analysis of Gr22e function:

  • Choice of GAL4 driver: Different drivers (e.g., Gr33a-GAL4 vs. Gr64f-GAL4) target different neuronal populations, affecting the interpretation of misexpression and rescue experiments.

  • Sensilla selection: Different sensilla (S-a, S-b, I-a, I-b) have distinct baseline responses to bitter compounds, so the specific sensilla analyzed can impact results.

  • Concentration ranges: The concentrations of bitter compounds used need to be carefully titrated to reveal phenotypic differences without overwhelming the system.

  • Genetic background control: Ensuring proper genetic background controls is essential, as unknown genetic differences can confound interpretations.

  • Combined approaches: Integrating behavioral assays with electrophysiological recordings and calcium imaging provides more comprehensive insights into Gr22e function than any single approach.

When analyzing phenotypes, statistical approaches like Kruskal-Wallis tests for multiple comparisons and Mann-Whitney U tests for pair-wise comparisons are commonly employed, with significance levels typically set at p < 0.05 or p < 0.01 .

How conserved is Gr22e across insect species and what does this suggest about its evolutionary significance?

While the search results don't provide specific information about Gr22e conservation across species, we can infer some aspects of gustatory receptor evolution more broadly. The insect gustatory receptors are members of a large G-protein coupled receptor family distantly related to insect olfactory receptors .

Comparative studies of Gr22e across Drosophila species and other insects could reveal whether its bitter sensing function is evolutionarily conserved or has diverged to adapt to different ecological niches.

Beyond taste: Does Gr22e have non-gustatory functions in Drosophila melanogaster?

While Gr22e is primarily characterized as a gustatory receptor, some gustatory receptors in Drosophila have been shown to have functions beyond external taste sensing. For example, Gr5a and Gr22e were reported to be coexpressed with Gr28a or Gr28b.c in neurosecretary cells that produce insulin-like peptides .

Since Gr5a is tuned to trehalose (a sugar), it may function not only as a taste receptor but also as an internal detector for blood sugar trehalose. By extension, it's possible that Gr22e may also have internal sensing functions beyond its role in external bitter taste perception .

This parallel can be drawn from mammalian systems, where taste receptors sometimes have dual functions. For instance, PKD2L1, a candidate mammalian sour taste sensor, also functions as a cerebrospinal fluid sensor in specific neurons surrounding the central canal of the spinal cord to detect decreases in extracellular pH in mice .

What are the main technical challenges in studying Gr22e expression and function?

Several technical challenges complicate the study of Gr22e and other gustatory receptors:

  • Low expression levels: In situ hybridization with Gr genes has been largely unsuccessful, likely due to their low expression levels .

  • Redundancy among receptors: Functional overlap between receptors like Gr22e and Gr59c can mask phenotypes in single-gene studies .

  • Complex formation requirements: Gustatory receptors typically function in heteromeric complexes, making it difficult to study individual receptor contributions .

  • Tissue-specific expression: Gr22e is expressed in specific sensilla and neurons, requiring precise methods for targeting these populations .

To overcome these challenges, researchers have employed:

  • The GAL4/UAS system for visualizing expression patterns

  • Rescue and misexpression experiments to confirm gene function

  • Double mutant analyses to address redundancy

  • Heterologous expression systems to study receptor complexes

  • Electrophysiology and calcium imaging to directly measure neuronal responses

How can gene editing approaches like CRISPR-Cas9 advance our understanding of Gr22e?

While not specifically mentioned in the search results, CRISPR-Cas9 gene editing offers several advantages for Gr22e research:

  • Precise mutations: Creating specific mutations or deletions in the Gr22e gene without affecting neighboring genes.

  • Endogenous tagging: Adding epitope tags or fluorescent proteins to the endogenous Gr22e locus to monitor expression and localization without overexpression artifacts.

  • Regulatory element manipulation: Modifying promoter or enhancer elements to understand transcriptional regulation of Gr22e.

  • Combinatorial editing: Simultaneously editing multiple gustatory receptor genes (e.g., Gr22e and Gr59c) to study compound phenotypes.

  • Conditional systems: Creating conditional knockout systems to study temporal requirements for Gr22e expression.

These approaches could overcome limitations of traditional genetic methods and provide more precise insights into Gr22e function and regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.