Recombinant Drosophila melanogaster Putative gustatory receptor 28a (Gr28a)

Shipped with Ice Packs
In Stock

Description

Introduction to Gr28a

Gr28a is a member of the evolutionarily conserved Gr28 gustatory receptor subfamily in Drosophila melanogaster. It functions as a taste receptor critical for detecting macronutrients, particularly ribonucleosides and RNA, which are essential for larval growth and survival . Unlike other Gr subfamilies, Gr28 genes exhibit functional divergence, with Gr28a mediating appetitive (attractive) responses, while closely related Gr28b subfamily members mediate aversive (repulsive) responses to bitter compounds .

Appetitive Taste for Ribonucleosides and RNA

Gr28a mediates a novel taste modality dedicated to detecting ribonucleosides and RNA:

Experimental ApproachFindingsMethodology
Ca²⁺ ImagingGr28a-expressing neurons respond to ribose, RNA, and ribonucleosides (e.g., adenosine, cytidine)
Behavioral AssaysLarvae exhibit strong attraction to RNA-containing agarose (Gr28a-dependent)
Mutant AnalysisGr28-deficient larvae show reduced survival when ribonucleosides are limited

Opposing Functions with Gr28b Subfamily

Gr28a and Gr28b.c neurons exhibit opposing valence in chemosensation:

ReceptorTarget LigandBehavioral ResponseExperimental Evidence
Gr28aRNA, ribonucleosidesAttractionVR1 expression in Gr28a-GAL4 neurons → capsaicin attraction
Gr28b.cDenatonium, quinineAvoidanceVR1 expression in Gr28b.c-GAL4 neurons → capsaicin avoidance

Recombinant Gr28a: Current Status and Challenges

While recombinant Gr28b protein is commercially available (e.g., Creative Biomart’s RFL23002DF, His-tagged) , no direct evidence of recombinant Gr28a production exists in the provided sources. This contrasts with Gr28b, which has been expressed in E. coli for structural studies .

Limitations in Recombinant Production

  1. Expression Challenges: Gr28a may form heteromeric complexes with other Gr proteins, complicating recombinant expression.

  2. Functional Specificity: Gr28a’s ligand-binding properties may require co-receptors (e.g., Gr43a for signal transduction) .

Evolutionary and Physiological Significance

  • Evolutionary Conservation: Gr28a homologs restore RNA preference in Gr28-mutant larvae when expressed from mosquitoes, indicating conserved function across dipterans .

  • Fitness Role: Gr28a-driven detection of ribonucleosides/RNA is critical during larval growth phases, as these nutrients support rapid development .

Key Research Gaps and Future Directions

  1. Structural Determination: High-resolution structures of Gr28a-ligand complexes remain elusive.

  2. Heteromerization: Potential interactions with other Gr proteins (e.g., Gr66a, Gr43a) require investigation .

  3. Beyond Gustation: Gr28a’s expression in the CNS and PNS suggests non-gustatory roles (e.g., thermoregulation, UV avoidance) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for the specific delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Gr28a; CG13787; Putative gustatory receptor 28a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr28a
Target Protein Sequence
MAFKLWERFSQADNVFQALRPLTFISLLGLAPFRLNLNPRKEVQTSKFSFFAGIVHFLFF VLCFGISVKEGDSIIGYFFQTNITRFSDGTLRLTGILAMSTIFGFAMFKRQRLVSIIQNN IVVDEIFVRLGMKLDYRRILLSSFLISLGMLLFNVIYLCVSYSLLVSATISPSFVTFTTF ALPHINISLMVFKFLCTTDLARSRFSMLNEILQDILDAHIEQLSALELSPMHSVVNHRRY SHRLRNLISTPMKRYSVTSVIRLNPEYAIKQVSNIHNLLCDICQTIEEYFTYPLLGIIAI SFLFILFDDFYILEAILNPKRLDVFEADEFFAFFLMQLIWYIVIIVLIVEGSSRTILHSS YTAAIVHKILNITDDPELRDRLFRLSLQLSHRKVLFTAAGLFRLDRTLIFTITGAATCYL IILIQFRFTHHMDDTSSNSTNNLHSIHLGD
Uniprot No.

Target Background

Function
This protein is a probable gustatory receptor that mediates acceptance or avoidance behavior based on its substrates. Its atypical expression suggests potential nongustatory roles in the nervous system and tissues involved in proprioception, hygroreception, and other sensory modalities. It is also possible that it has chemosensory roles in the detection of internal ligands.
Database Links

KEGG: dme:Dmel_CG13787

STRING: 7227.FBpp0079087

UniGene: Dm.26354

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr2a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
In addition to expression in a large number of taste neurons, Gr28a is also expressed in a few nonchemosensory neurons, including the campaniform sensilla of the wing, leg stretch receptors, and multiple dendritic (MD) neurons in the abdomen. In larvea, i

Q&A

What is the genomic organization of the Gr28 gene subfamily in Drosophila melanogaster?

The Gr28 gene subfamily consists of six closely related gustatory receptor genes that are tightly clustered in the Drosophila genome. This includes Gr28a and five Gr28b genes (Gr28b.a-e). While Gr28a exists as a separate transcription unit, the five Gr28b genes share a unique genomic arrangement where they are transcribed from distinct promoters and have unique first exons that are spliced to shared second and third exons . This organization reflects the evolutionary history of these genes, which likely arose through recent gene duplication events, as evidenced by their high sequence similarity (≥50%) .

The genetic conservation between Gr28 proteins is remarkably high, which is characteristic of genes generated through recent gene duplication events. This conservation extends beyond Drosophila - Gr28 homologs can be found across all insect families and even in more distant arthropods, making it one of the most conserved Gr subfamilies .

What is the expression pattern of Gr28a in Drosophila larvae?

Gr28a exhibits a specific expression pattern in Drosophila larvae that is largely non-overlapping with other members of the Gr28 subfamily. Expression analysis using Gr28a-GAL4 drivers reveals that Gr28a is expressed in approximately four pairs of gustatory receptor neurons (GRNs) . These neurons are distributed across both external and internal taste organs, including the terminal organ (TO) and the dorsal/ventral pharyngeal sensilla (DPS/VPS) .

Interestingly, there is minimal overlap in expression between Gr28a and other Gr28b genes, with only a single pair of neurons co-expressing both Gr28a and Gr28b.c . This distinct expression pattern suggests functional specialization among the Gr28 subfamily members. Beyond the gustatory system, Gr28a is also expressed in the central nervous system and non-chemosensory neurons of the peripheral nervous system, indicating potential functions beyond taste perception .

What is the primary function of Gr28a in Drosophila larvae?

Gr28a functions primarily as a receptor for nutritious RNA, ribonucleosides, and ribose in Drosophila larvae . When larvae encounter these compounds, Gr28a-expressing gustatory neurons are activated, triggering an attractive feeding behavior. This has been demonstrated through multiple complementary approaches:

  • Loss-of-function studies: Larvae homozygous for a Gr28 deletion mutation (ΔGr28) lose their ability to sense RNA, ribonucleosides, and ribose in two-choice feeding preference assays .

  • Rescue experiments: Expression of UAS-Gr28a transgenes in Gr28a-GAL4 neurons restores the attraction to RNA and related compounds in ΔGr28 mutant larvae .

  • Artificial activation: When the mammalian Vanilloid Receptor 1 (VR1) is expressed in Gr28a neurons, larvae become attracted to capsaicin (the VR1 ligand), indicating that these neurons intrinsically mediate attractive behavior regardless of the activating stimulus .

These findings collectively establish Gr28a as an essential component in the detection pathway for RNA and ribose, which represent appetitive nutritional cues for developing larvae.

How does Gr28a-mediated behavior differ from other Gr28 subfamily members?

One of the most fascinating aspects of the Gr28 subfamily is that different members mediate opposing behavioral outcomes despite their structural similarity. While Gr28a activation leads to attraction behavior, activation of neurons expressing other Gr28 subfamily members, particularly Gr28b.c, triggers strong avoidance behavior .

This functional divergence was elegantly demonstrated through heterologous expression of the mammalian Vanilloid Receptor 1 (VR1) in different Gr28-expressing neurons:

Gr28 neuron typeResponse to capsaicin when expressing VR1Behavioral outcome
Gr28a neuronsStrong attraction"Go toward" chemical source
Gr28b.c neuronsStrong avoidance"Go away" from chemical source
Gr28b.a/e neurons (TO pair only)No behavioral effectInsufficient for avoidance

This remarkable functional divergence within a closely related receptor subfamily highlights the complexity of taste coding in Drosophila and demonstrates that the valence of a chemical compound can be dependent on neuronal identity rather than receptor identity alone .

What are the validated approaches for studying Gr28a function in vivo?

Several complementary experimental approaches have been validated for investigating Gr28a function in Drosophila:

  • Two-choice feeding preference assays: This behavioral paradigm allows researchers to quantify larval attraction or aversion to specific compounds. Larvae are placed between two choice zones containing different substrates (e.g., control versus RNA), and their distribution is measured over time .

  • Heterologous receptor expression: The mammalian Vanilloid Receptor 1 (VR1) can be expressed in specific gustatory neurons using the GAL4/UAS system. Since Drosophila lacks endogenous VR1-like genes and does not respond to capsaicin, this approach allows researchers to artificially activate targeted neuronal populations and observe the resulting behaviors .

  • Calcium imaging: Live Ca²⁺ imaging of Gr28-expressing neurons enables direct visualization of neuronal responses to various tastants. This approach has been used to show that Gr28b.c neurons respond to bitter compounds like denatonium benzoate and quinine .

  • Neuronal inactivation experiments: Targeted expression of inhibitory proteins (such as tetanus toxin) in specific neuronal populations allows researchers to determine which neurons are necessary for particular taste-driven behaviors .

  • Rescue experiments with transgenic receptors: Expression of specific Gr28 transgenes in mutant backgrounds can reveal which receptor subunits are sufficient to restore lost functions .

These methodologies provide a robust toolkit for dissecting the functional properties of Gr28a and other gustatory receptors in the context of intact neural circuits.

How can researchers generate and validate Gr28a transgenic constructs?

For researchers working with recombinant Gr28a, proper generation and validation of transgenic constructs are critical. Based on established protocols in the field:

  • Construct design:

    • For GAL4 driver lines: The regulatory regions (typically 5' upstream sequences) of Gr28a should be fused to GAL4 coding sequences.

    • For UAS-Gr28a rescue constructs: The full Gr28a coding sequence should be cloned downstream of UAS elements.

  • Validation approaches:

    • Expression pattern verification: Generate multiple independent insertion lines (at least two) for each transgene to confirm consistent expression patterns .

    • Functional validation: Test transgene function through rescue experiments in ΔGr28 mutant backgrounds, measuring restored behavioral responses to RNA/ribose .

    • Cross-species validation: Comparative analysis with Gr28a homologs from other insect species can provide insights into conserved functional domains .

  • Important considerations:

    • The bimodal expression systems (GAL4/UAS) can generally be expected to represent endogenous Gr expression when properly validated with multiple insertion lines .

    • For recombinant protein production, codon optimization may improve expression levels in heterologous systems.

Researchers should note that results from different GAL4 driver lines may show some variation, highlighting the importance of using multiple independent lines to validate experimental findings .

How do Gr28a-mediated responses integrate with broader taste coding in Drosophila larvae?

Gr28a participates in a sophisticated taste coding system where the valence of gustatory information (attraction versus aversion) depends on both receptor identity and neuronal context. Advanced research questions in this area include:

The integration of Gr28a-mediated responses with other taste modalities involves complex neural circuitry. The "go-to" neurons characterized by Gr28a expression comprise four GRN pairs distributed across both external and internal taste organs . In contrast, the "go-away" neurons expressing Gr28b.c and Gr66a consist of only two pairs (one in the terminal organ and another in the DPS/VPS) .

This minimal circuit architecture raises several intriguing questions about taste integration:

  • How do these numerically small neuronal ensembles exert such profound behavioral effects?

  • What downstream neural circuits process and integrate these opposing taste signals?

  • How is potential conflicting information (e.g., simultaneous activation of attractive and aversive pathways) resolved at the circuit level?

Interestingly, one pair of neurons in the DPS/VPS co-expresses both Gr28a (associated with RNA attraction) and Gr28b.c (associated with bitter aversion), suggesting potential for integration even at the sensory neuron level . This dual expression pattern might enable sophisticated context-dependent modulation of taste responses.

What is the molecular mechanism of Gr28a-mediated RNA/ribose sensing?

The molecular mechanisms underlying Gr28a-mediated RNA and ribose detection remain incompletely understood and represent an active area of investigation. Current evidence suggests:

  • Receptor composition: Gr28a likely functions as part of a multimeric receptor complex, similar to other insect gustatory receptors. The specific subunit composition of this complex and the contributions of individual subunits to ligand binding remain to be fully elucidated.

  • Structure-function relationships: Comparative analysis of Gr28a with functionally distinct Gr28b proteins could reveal key residues important for ligand specificity. For example, when comparing the unique N-terminal halves of Gr28 proteins (comprising the first four transmembrane domains and extracellular loops 1 and 2), only seven residues are identical between Gr28b.a and Gr28b.c . These conserved residues might be particularly important for specific ligand interactions.

DomainNumber of identical residues between Gr28b.a and Gr28b.cPotential significance
N-terminal half7 residuesMay contribute to specific ligand recognition
With reduced stringency16 residuesMay contribute to general receptor function

Advanced approaches to investigate these mechanisms might include:

  • Site-directed mutagenesis of conserved residues

  • Chimeric receptor construction between Gr28a and Gr28b proteins

  • Structural modeling based on emerging cryo-EM data for related receptors

  • Heterologous expression systems for direct ligand binding assays

What is the evolutionary significance of Gr28a conservation across insect species?

The remarkable evolutionary conservation of the Gr28 subfamily across diverse insect species raises fascinating questions about its ancestral functions and adaptive significance. Gr28 homologs can be found across all insect families and even in more distant arthropods, suggesting they emerged over 260 million years ago .

Several lines of evidence highlight the evolutionary importance of Gr28a:

  • Cross-species functional conservation: Gr28a homologs from mosquitoes (Aedes aegypti and Anopheles gambiae) can restore RNA and ribose preference when expressed in Gr28a neurons of ΔGr28 mutant Drosophila larvae . This functional rescue across species separated by 260 million years of evolution demonstrates extraordinary conservation of receptor function.

  • RNA as a conserved appetitive cue: RNA has been identified as an appetitive taste ligand across many dipteran insects, including mosquitoes . This suggests that RNA detection might represent an ancestral function of Gr28a homologs that has been maintained under strong selective pressure.

  • Functional diversification: Despite their structural similarity, different Gr28 subfamily members have evolved distinct functions - from RNA detection (Gr28a) to bitter compound detection (Gr28b.c/a) to even non-gustatory roles in high-temperature and UV light avoidance (Gr28b.d) .

This evolutionary pattern suggests that the Gr28 subfamily may have originated with a core function in detecting nutritionally relevant compounds, with subsequent duplications and divergence leading to expanded sensory capabilities while maintaining the ancestral structure.

How can researchers overcome limitations in studying recombinant Gr28a expression?

Researchers face several technical challenges when working with recombinant Gr28a:

  • Validation of expression patterns: GAL4 driver lines from different studies can exhibit varying expression patterns, creating challenges for precise characterization .

    Solution: Use multiple independent insertion lines for each transgene and validate expression patterns across developmental stages. Cross-referencing with complementary techniques such as CRISPR-based tagging of endogenous loci can provide additional validation.

  • Functional redundancy: Some degree of functional redundancy exists among Gr28 subfamily members, complicating the interpretation of single-gene manipulations .

    Solution: Employ comprehensive genetic approaches including single gene knockouts, multiple gene knockouts, and rescue experiments with individual genes to disentangle shared and unique functions.

  • Receptor complex composition: Like many insect gustatory receptors, Gr28a likely functions as part of a multimeric complex, making it difficult to study in isolation .

    Solution: Co-expression studies with candidate partner receptors, combined with techniques like FRET (Fluorescence Resonance Energy Transfer) or BiFC (Bimolecular Fluorescence Complementation), can help identify interaction partners.

What approaches are most effective for analyzing contradictory data in Gr28a research?

When researchers encounter contradictory data regarding Gr28a function or expression, several approaches can help resolve these discrepancies:

  • Methodological reconciliation: Different experimental approaches (behavioral assays, calcium imaging, electrophysiology) may produce apparently contradictory results. Carefully comparing methodological details can often explain discrepancies.

  • Genetic background effects: Variations in genetic background can significantly influence experimental outcomes, especially for behavioral phenotypes.

    Solution: Perform experiments in consistent genetic backgrounds or include appropriate genetic controls. When comparing across studies, consider backcrossing mutants into a common background.

  • Developmental differences: Gr28a expression and function may vary across developmental stages, potentially leading to contradictory findings.

    Solution: Clearly define the developmental stage being examined and consider performing comparative analyses across multiple stages when discrepancies arise.

  • Neuronal context dependence: The same receptor may function differently depending on the neuronal context (e.g., co-expression with other receptors).

    Solution: Detailed characterization of receptor co-expression patterns and cell-specific manipulations can help resolve context-dependent functions.

What are the most promising approaches for identifying novel ligands for Gr28a?

The identification of novel ligands for Gr28a represents an important research frontier. While RNA and ribose have been established as Gr28a ligands, the receptor might respond to additional compounds. Promising approaches include:

  • High-throughput screening: Systematic testing of diverse chemical libraries using calcium imaging or behavioral assays could identify new activators or modulators of Gr28a function.

  • Structural modeling and virtual screening: As structural information for insect gustatory receptors improves, computational approaches may help predict potential ligands based on binding pocket characteristics.

  • Metabolomics-guided discovery: Profiling natural food sources that elicit strong Gr28a-dependent responses could identify novel biologically relevant ligands.

  • Cross-species comparative approach: Investigating compounds that activate Gr28a homologs in other insect species might reveal conserved or divergent ligand preferences.

  • Structure-activity relationship studies: Systematic modification of known ligands (RNA derivatives, nucleosides, etc.) could help define the chemical features required for Gr28a activation.

How might understanding Gr28a function contribute to broader neuroscience questions?

Research on Gr28a has implications that extend beyond gustation to address fundamental questions in neuroscience:

  • Sensory valence encoding: The Gr28 subfamily provides a unique model for studying how closely related receptors can mediate opposing behavioral responses (attraction versus aversion) . This system could help elucidate general principles of how sensory valence is encoded at the molecular and circuit levels.

  • Evolutionary plasticity of sensory systems: The functional diversification within the Gr28 subfamily, despite high sequence conservation, offers insights into how sensory systems evolve new capabilities while maintaining core functions .

  • Multimodal sensory integration: Given that Gr28 family members are expressed not only in the gustatory system but also in the central nervous system and non-chemosensory neurons, they may participate in integrating information across multiple sensory modalities .

  • Developmental neurobiology: The establishment and maintenance of the distinct expression patterns of Gr28 subfamily members raise interesting questions about the developmental mechanisms that regulate sensory neuron specialization.

  • Comparative neurobiology: The extraordinary conservation of Gr28 across insect species provides opportunities for comparative studies to understand fundamental principles of chemosensation that may apply across diverse species, potentially including mammals.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.