Recombinant Drosophila melanogaster Putative gustatory receptor 36a (Gr36a)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics and Production

Product Details ( ):

  • Product Code: CSB-EP349274DLU1

  • Source: Expressed in E. coli

  • Length: 391 amino acids (partial sequence)

  • Purity: >85% (SDS-PAGE verified)

  • Tag: Determined during manufacturing (unspecified)

  • Storage:

    • Liquid form: 6 months at -20°C/-80°C

    • Lyophilized form: 12 months at -20°C/-80°C

Reconstitution:

  • Requires deionized sterile water (0.1–1.0 mg/mL concentration).

  • Glycerol (5–50%) recommended for long-term stability .

Evolutionary Relationships ( ):

  • Gene Location: Adjacent to Gr36a/b/c cluster in the Drosophila genome, suggesting duplication from a Gr36-like ancestor.

  • Intron Motifs: Shares a phase 0 intron position with Gr36 homologs, indicating conserved splicing mechanisms.

  • TM7 Motif: Variant motif (T(H/N)(S/A)hhhhQ(Y/F/W)) aligns with Gr36 and Gr59c/d subfamilies .

Predicted Topology ( ):

  • Cellular Localization: Integral to membranes.

  • Functional Domains: Seven transmembrane helices (7TM), characteristic of insect gustatory receptors (GRs).

Bitter Compound Detection ( ):

  • Primary Role: Mediates acceptance or avoidance behaviors depending on substrate.

  • L-Canavanine Detection: Cooperates with GR8a and GR98b to sense this plant-derived insecticide. Co-expression in bitter-sensing gustatory receptor neurons (GRNs) confers responsiveness .

Behavioral Modulation:

  • Misexpression of Gr36a with Gr8a and Gr98b in sweet-sensing GRNs switches L-canavanine from aversive to attractive .

Key Studies:

  1. Subunit Complexity ( ):

    • Gr36a functions as part of a multi-subunit receptor complex, similar to GR66a and GR93a in caffeine detection.

    • Requires co-expression with other GRs (e.g., GR8a, GR98b) for ligand specificity.

  2. Genetic Screens ( ):

    • Evolutionary analysis reveals rapid divergence of Gr36a-like receptors in drosophilids, driven by gene duplication and motif variation.

Interaction Network

Predicted Functional Partners ( ):

PartnerFunctionInteraction Score
Gr92aMediates substrate-dependent acceptance/avoidance; part of Gr93a subfamily.0.827
Gr98bCo-detects L-canavanine; required for bitter compound sensing.0.703
Gr28bExpressed in proprioceptive and hygroreceptive tissues; linked to chemosensory roles.0.700

Applications and Implications

  • Toxicology: Studying Gr36a interactions aids in understanding insecticide resistance mechanisms .

  • Neuroscience: Serves as a model for dissecting taste receptor combinatorial logic in eukaryotes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag.
Synonyms
Gr36a; CG31747; Putative gustatory receptor 36a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr36a
Target Protein Sequence
MFDWVGLLLKVLYYYGQIIGLINFEIDWQRGRVVAAQRGILFAIAINVLICMVLLLQISK KFNLDVYFGRANQLHQYVIIVMVSLRMASGISAILNRWRQRAQLMRLVECVLRLFLKKPH VKQMSRWAILVKFSVGVVSNFLQMAISMESLDRLGFNEFVGMASDFWMSAIINMAISQHY LVILFVRAYYHLLKTEVRQAIHESQMLSEIYPRRAAFMTKCCYLADRIDNIAKLQNQLQS IVTQLNQVFGIQGIMVYGGYYIFSVATTYITYSLAINGIEELHLSVRAAALVFSWFLFYY TSAILNLFVMLKLFDDHKEMERILEERTLFTSALDVRLEQSFESIQLQLIRNPLKIEVLD IFTITRSSSAAMIGSIITNSIFLIQYDMEYF
Uniprot No.

Target Background

Function
This protein is a probable gustatory receptor that mediates acceptance or avoidance behavior in Drosophila melanogaster, depending on its substrates.
Database Links

KEGG: dme:Dmel_CG31747

STRING: 7227.FBpp0080515

UniGene: Dm.26372

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr22e subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Drosophila melanogaster Gr36a?

Gr36a (Putative gustatory receptor 36a) is a membrane protein belonging to the insect chemoreceptor superfamily and specifically to the gustatory receptor (GR) family in Drosophila melanogaster. It functions as a probable gustatory receptor that mediates acceptance or avoidance behavior depending on its substrates . The full-length protein consists of 391 amino acids and contains multiple transmembrane domains typical of chemosensory receptors . Gr36a is part of a specific subfamily within the larger gustatory receptor family and plays an important role in the fly's chemosensory system.

Where is Gr36a expressed in Drosophila melanogaster?

Gr36a is specifically expressed in gustatory neurons of Drosophila melanogaster. Transcriptomic analysis has detected Gr36a expression at levels >0.5 FKPM in proboscis tissue. Importantly, within the Fly Cell Atlas dataset of the proboscis and maxillary palp, Gr36a is specifically expressed in the cluster of cells corresponding to Gr66a-expressing bitter/aversive neurons . This expression pattern strongly suggests Gr36a functions in aversive taste perception pathways. Unlike some other gustatory receptors, Gr36a expression appears to be restricted to taste organs and is not detectably expressed in other chemosensory tissues such as legs, wings, or antennae.

How does Gr36a relate evolutionarily to other gustatory receptors?

Phylogenetic analyses reveal Gr36a belongs to a distinct evolutionary clade within the gustatory receptor family. Gr36a is closely related to Gr59c/d, with which it shares a variant TM7 motif (T(H/N)(S/A)hhhhQ(Y/F/W), where h represents hydrophobic residues) that differs from the canonical TM7 motif of gustatory receptors (TYhhhhhQF) .

A particularly significant evolutionary relationship exists between Gr36a and Grl36a. These genes are located in close genomic proximity (separated by only 306 bp) in the D. melanogaster genome, suggesting Grl36a might have arisen by gene duplication of a Gr36-like ancestor. Phylogenetic analyses support that a Grl36a/Grl43a clade is the sister clade to Gr36, and that this split occurred after the emergence of the Gr59c/d clade .

The evolutionary relationships can be summarized in the following proposed model:

Evolutionary EventDescription
Ancestral splitGr59 clade diverges from common ancestor
Secondary splitGr36 and Grl36a/43a diverge as sister clades
Recent evolutionConservation of genomic arrangement in drosophilids

This evolutionary relationship is supported by multiple lines of evidence including sequence similarity, conserved intron positions, and genomic synteny across drosophilid species .

What functional protein interactions has Gr36a been shown to participate in?

Gr36a participates in a complex network of protein interactions with other gustatory receptors. Protein interaction data reveals significant functional connections with several other gustatory receptors, suggesting Gr36a may function within heteromeric receptor complexes. The most prominent interaction partners include:

Interaction PartnerInteraction ScoreFunctional Relationship
Gr92a0.827Highest confidence interaction; likely co-expressed in same neurons
Gr98b0.703High confidence interaction
Gr93d0.701High confidence interaction
Gr28b0.700High confidence interaction; possibly co-expressed
Gr22f0.699High confidence interaction
Gr22a0.695High confidence interaction

These interactions suggest Gr36a functions within a network of gustatory receptors, potentially forming heteromeric complexes that collectively respond to specific chemical stimuli . The high interaction score with Gr92a (0.827) is particularly noteworthy and suggests these receptors may function together in detecting specific bitter compounds.

What is the relationship between gene structure and function for Gr36a?

The gene structure of Gr36a provides insights into its function and evolution. Unlike many members of the gustatory receptor family that possess three C-terminal, phase 0 introns, Gr36a (along with Gr59c/d) possesses only one of these introns. This intron corresponds to the second ancestral gustatory receptor intron located just before the exon encoding the seventh transmembrane domain (TM7) .

The TM7 domain is particularly significant for function, containing a specialized motif that differs from the canonical gustatory receptor motif. While the canonical TM7 motif is TYhhhhhQF (where h represents hydrophobic residues), Gr36a shares a variant motif with Gr59c/d: T(H/N)(S/A)hhhhQ(Y/F/W) .

This specialized motif likely influences the ligand binding properties and signal transduction capabilities of Gr36a, potentially contributing to its specificity for certain bitter compounds. The conservation of this variant motif across related receptors suggests functional significance in aversive taste perception.

How can recombinant Gr36a protein be produced and purified?

Recombinant Gr36a can be produced through heterologous expression in E. coli systems. The full-length sequence (amino acids 1-391) can be expressed with an N-terminal His-tag to facilitate purification. The detailed methodology includes:

  • Vector construction: The coding sequence for Gr36a is cloned into an appropriate expression vector with an N-terminal His-tag.

  • Expression conditions: Transformed E. coli cells are cultured under optimized conditions to induce protein expression.

  • Purification: The recombinant protein is purified using affinity chromatography methods specific for His-tagged proteins.

  • Quality assessment: SDS-PAGE analysis confirms protein purity (>90% purity is achievable) .

The purified protein is typically provided as a lyophilized powder in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . For optimal stability during storage, it is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add glycerol to a final concentration of 5-50% before aliquoting for long-term storage at -20°C/-80°C .

What are the optimal storage and handling conditions for recombinant Gr36a?

Optimal storage and handling of recombinant Gr36a requires specific conditions to maintain protein stability and functionality:

ParameterRecommended Conditions
Receipt storageStore at -20°C/-80°C immediately upon receipt
Working aliquotsStore at 4°C for up to one week
Long-term storageAliquot with 5-50% glycerol and store at -20°C/-80°C
ReconstitutionUse deionized sterile water to 0.1-1.0 mg/mL
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Stability considerationsAvoid repeated freeze-thaw cycles

Before opening, it is recommended to briefly centrifuge the vial to bring contents to the bottom. After reconstitution, the addition of glycerol (typically to a final concentration of 50%) helps prevent damage during freezing and extends the protein's shelf life .

How can functional assays be designed to study Gr36a activity?

Designing functional assays for Gr36a requires consideration of its role as a gustatory receptor involved in aversive responses. Multiple complementary approaches can be employed:

  • Heterologous expression systems: Expressing Gr36a (potentially along with interaction partners like Gr92a) in cell lines such as HEK293 cells, followed by calcium imaging or electrophysiological recording to measure responses to potential ligands.

  • In vivo behavioral assays: Using Drosophila strains with Gr36a mutations or RNAi knockdowns to assess behavioral changes in response to specific tastants. Two-choice feeding assays can quantify preference or avoidance.

  • Neuronal activity monitoring: Employing GCaMP or other calcium indicators in Gr36a-expressing neurons to measure activity in response to tastant application.

  • Co-immunoprecipitation studies: Investigating physical interactions between Gr36a and other gustatory receptors such as Gr92a to understand the composition of functional receptor complexes.

When designing these assays, it's crucial to consider that Gr36a likely functions in bitter/aversive neurons and may require co-expression of other receptors to form functional complexes .

What evidence supports the evolutionary relationship between Gr36a and Grl36a?

Multiple lines of evidence support an evolutionary relationship between Gr36a and Grl36a, suggesting these genes share a common ancestry:

  • Genomic proximity: In D. melanogaster, Grl36a is located immediately adjacent to the Gr36a/b/c cluster, separated by only 306 base pairs. This proximity suggests Grl36a might have arisen through gene duplication of a Gr36-like ancestor .

  • Conserved synteny: Across drosophilid species, Grl36a homologs are consistently found in tandem with Gr36-related genes in various arrangements, supporting their evolutionary relationship .

  • Intron conservation: Both Gr36a and Grl36a possess a phase 0 intron immediately before the exon encoding the seventh transmembrane domain (TM7). This shared intron position aligns perfectly on multiple protein sequence alignments, suggesting these introns are homologous .

  • TM7 motif similarity: Gr36a and Grl36a share a similar variant of the canonical TM7 motif found in gustatory receptors. While the canonical motif is TYhhhhhQF (where h is a hydrophobic residue), both Gr36a and Grl36a share a variant motif T(H/N)(S/A)hhhhQ(Y/F/W) .

  • Phylogenetic analyses: Maximum likelihood phylogeny and Bayesian analyses support that Gr36a and Grl36a/Grl43a are sister clades that likely split after the emergence of the Gr59c/d clade .

This combination of genomic, structural, and phylogenetic evidence strongly supports a relatively recent common ancestry between Gr36a and Grl36a within drosophilids.

What structural features distinguish Gr36a from other gustatory receptors?

Gr36a possesses several structural features that distinguish it from other members of the gustatory receptor family:

  • Variant TM7 motif: Unlike most gustatory receptors that contain the canonical TM7 motif (TYhhhhhQF), Gr36a contains a variant motif T(H/N)(S/A)hhhhQ(Y/F/W). This specialized motif is shared only with closely related receptors like Gr59c/d, Grl36a, and Grl43a .

  • Intron structure: While the gustatory receptor family is characterized by the general conservation of three C-terminal, phase 0 introns, Gr36a possesses only one of these introns. This corresponds to the second ancestral gustatory receptor intron located just before the exon encoding TM7 .

  • Sequence features: The 391-amino acid sequence of Gr36a contains specific hydrophobic regions forming transmembrane domains and connecting loops that likely contribute to its ligand specificity and binding properties .

These structural distinctions likely contribute to the functional specialization of Gr36a within the gustatory receptor family and may explain its specific role in detecting certain aversive compounds.

What is the proposed functional role of Gr36a in Drosophila gustation?

Gr36a is proposed to function primarily in aversive taste perception in Drosophila melanogaster. Several lines of evidence support this functional role:

Based on these observations, Gr36a likely functions as a component of receptor complexes involved in detecting specific bitter or aversive compounds, triggering avoidance behaviors when these compounds are encountered. The exact compounds detected by Gr36a-containing receptor complexes remain to be fully characterized, but they are likely aversive tastants relevant to the fly's ecological niche.

How do Gr36a protein interactions inform our understanding of its function?

The protein interaction network of Gr36a provides valuable insights into its functional role and mechanisms:

  • Heteromeric complex formation: The high-confidence interactions between Gr36a and other gustatory receptors (particularly Gr92a, Gr98b, Gr93d, Gr28b, Gr22f, and Gr22a) suggest it functions within heteromeric receptor complexes . This is consistent with the general understanding that many insect chemoreceptors function as heteromultimers rather than homomultimers.

  • Functional specialization: The specific interaction partners of Gr36a suggest a specialized role in detecting certain compounds. The particularly strong interaction with Gr92a (score 0.827) indicates these proteins may frequently function together, potentially detecting related compounds or forming a stable receptor subcomplex .

  • Signal transduction pathways: The interaction network provides clues about the potential signal transduction pathways activated by Gr36a-containing complexes. Interactions with multiple other receptors suggest a combinatorial coding mechanism, where different receptor combinations detect different compounds.

This interaction data suggests a model where Gr36a forms heteromeric complexes with specific combinations of other gustatory receptors, contributing to the discrimination of various bitter compounds and triggering appropriate avoidance behaviors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.