Recombinant Drosophila melanogaster Putative gustatory receptor 36b (Gr36b)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Drosophila melanogaster Putative Gustatory Receptor 36b (Gr36b)

Recombinant Drosophila melanogaster Putative Gustatory Receptor 36b (Gr36b) is a genetically engineered protein derived from the fruit fly's gustatory receptor (Gr) family. Gr36b is part of a chemosensory system that enables Drosophila to detect environmental chemicals, including nutrients and toxins . This receptor is classified under the insect-specific Gr family, which comprises 60 genes encoding 68 proteins through alternative splicing . Recombinant Gr36b is commercially available for research purposes, typically produced in heterologous expression systems and sold at premium prices (e.g., $4,850.00 per unit) .

Expression Patterns

Gr36b is co-expressed with other Grs in specific gustatory receptor neurons (GRNs):

Co-expressed GrsTissue LocalizationFunctional Implication
Gr22e, Gr32a, Gr36cLabellar taste sensillaBitter compound detection
Gr28b.e, Gr58bTerminal organ ganglionAvoidance behavior modulation

Role in Chemosensation

While direct functional studies on Gr36b remain limited, its co-expression patterns and phylogenetic relationships provide insights:

  1. Bitter taste processing: Co-localizes with Gr66a-expressing neurons implicated in avoidance behaviors

  2. Receptor complex formation: Likely functions as part of multimeric receptor complexes, similar to Gr28 subfamily members

  3. Evolutionary plasticity: Shows evidence of recent selective pressure in D. melanogaster populations

Comparative Analysis with Related Grs

ReceptorFunctionExpression Overlap
Gr36bPutative bitter sensorGr22e, Gr32a, Gr36c
Gr28aAppetitive RNA detectionIndependent of Gr36b neurons
Gr66aBroad-spectrum aversive compound detectionPartial overlap in internal GRNs

Experimental Utility

  1. Functional studies: Enables heterologous expression in non-native GRNs to investigate receptor specificity

  2. Structural biology: Serves as substrate for cryo-EM studies of insect chemoreception mechanisms

  3. Evolutionary analyses: Provides molecular tool for studying chemosensory adaptation across Diptera

Knowledge Gaps and Future Directions

  1. Ligand specificity: No direct binding assays reported for Gr36b

  2. Neural circuitry: Precise projection patterns of Gr36b-expressing GRNs remain uncharacterized

  3. Behavioral relevance: Requires validation through targeted mutagenesis studies

Current research priorities include determining Gr36b's role in:

  • Natural ligand identification

  • Interspecies conservation analysis

  • Contribution to oviposition site selection

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your usage.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gr36b; CG31744; Putative gustatory receptor 36b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr36b
Target Protein Sequence
MVDWVVLLLKAVHIYCYLIGLSNFEFDCRTGRVFKSRRCTIYAFMANIFILITIIYNFTA HGDTNLLFQSANKLHEYVIIIMSGLKIVAGLITVLNRWLQRGQMMQLVKDVIRLYMINPQ LKSMIRWGILLKAFISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSFIMNLAISQHF LVILLIRAQYRIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCYLSDQLEDIGEVQSQLQS MVGQLDEVFGMQGLMAYSEYYLSIVGTSYMSYSIYKYGPHNLKLSAKTSIIVCILITLFY LDALVNCNNMLRVLDHHKDFLGLLEERTVFASSLDIRLEESFESLQLQLARNPLKINVMG MFPITRGSTAAMCASVIVNSIFLIQFDMEFF
Uniprot No.

Target Background

Function
This is a probable gustatory receptor that mediates acceptance or avoidance behavior in response to its substrates.
Database Links

KEGG: dme:Dmel_CG31744

STRING: 7227.FBpp0080516

UniGene: Dm.26371

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr22e subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in neurons of the terminal external chemosensory organ of larvae.

Q&A

What is Drosophila melanogaster Gr36b and how is it classified within the gustatory receptor family?

Drosophila melanogaster Gr36b is a member of the gustatory receptor (GR) family, which belongs to a large G-protein coupled receptor family that is distantly related to insect olfactory receptors . It is classified among the 60+ gustatory receptor genes in Drosophila that encode chemosensory receptors responsible for taste perception. Currently, Gr36b has been identified as a putative gustatory receptor, though its specific ligands and activation parameters are still being investigated in comparison to better-characterized GRs like GR43a and GR64a .

What expression patterns have been observed for Gr36b in Drosophila melanogaster?

Expression analysis of Gr36b has been challenging due to the typically low expression levels of gustatory receptor genes, which has made traditional in situ hybridization methods largely unsuccessful . The GAL4-UAS system has proven more effective for analyzing expression patterns of gustatory receptors in Drosophila . While comprehensive expression data specifically for Gr36b is limited in the available literature, it appears to be listed among the gustatory receptors (entry numbers 30 and 31) in systematic classification studies . Unlike some other GRs that have been detected in specific tissues such as labellum (L), proboscis (P), wing (W), or thorax (T), the expression pattern of Gr36b requires further characterization.

How do researchers differentiate between Gr36b and other members of the Gr36 cluster (Gr36a, Gr36c)?

Researchers differentiate between Gr36b and other members of the Gr36 cluster (Gr36a, Gr36c) primarily through molecular techniques such as RT-PCR with gene-specific primers and sequencing of the amplified products . The different Gr36 receptors (a, b, c) are distinguished by their unique nucleotide and amino acid sequences, despite potentially sharing structural similarities. Expression analysis using the GAL4-UAS system can also reveal differences in spatial expression patterns among these closely related receptors . Additionally, electrophysiological and calcium imaging methods may be employed to identify functional differences between these receptors when expressed in different neuronal populations.

What are the most effective expression systems for studying recombinant Gr36b function?

The GAL4-UAS binary expression system has proven to be the most successful approach for studying gustatory receptor expression and function in Drosophila, including Gr36b . This system allows for targeted expression of the receptor in specific tissues or cells. For functional studies, researchers typically:

  • Generate transgenic fly lines containing Gr36b promoter regions fused to GAL4

  • Cross these lines with UAS-reporter lines (e.g., UAS-GFP, UAS-RFP) to visualize expression

  • For functional analysis, cross with UAS-Gr36b lines to manipulate expression levels

For in vitro studies, heterologous expression systems such as Xenopus oocytes or HEK293 cells may be used, though gustatory receptors often show poor functional expression in these systems compared to the more successful studies with olfactory receptors. Studies of GR43a and GR64a have demonstrated that these receptors form tetrameric sugar-gated cation channels , suggesting similar approaches may be applicable to Gr36b characterization.

What electrophysiological methods are most appropriate for characterizing Gr36b function?

Based on successful approaches with other Drosophila gustatory receptors, the following electrophysiological methods are recommended for characterizing Gr36b function:

  • Tip recordings: This technique involves placing a glass electrode containing tastants and electrolyte solution over single sensilla to record neuronal activity when stimulated with potential ligands .

  • Whole-cell patch clamp recordings: For detailed biophysical characterization of channel properties when Gr36b is expressed in heterologous systems or isolated neurons.

  • Calcium imaging: Using genetically encoded calcium indicators (e.g., GCaMP) expressed in Gr36b-positive cells to monitor activation in response to potential ligands .

Similar to studies on GR43a and GR64a, these methods can help determine if Gr36b forms ligand-gated cation channels and identify its specific activating compounds . When designing these experiments, researchers should consider the potential for Gr36b to function in heteromeric complexes with other gustatory receptors, as observed with other GRs.

How can I generate and validate a Gr36b knockout for functional studies?

To generate and validate a Gr36b knockout for functional studies, researchers should consider the following methodology:

Generation approaches:

  • CRISPR/Cas9 gene editing

    • Design guide RNAs targeting the Gr36b coding sequence

    • Screen for successful deletions or mutations disrupting the reading frame

    • Establish homozygous lines

  • Alternative approaches:

    • P-element-mediated mutagenesis if available

    • RNAi knockdown (for partial loss of function)

Validation methods:

  • Molecular validation:

    • PCR amplification of the targeted region followed by sequencing

    • RT-PCR to confirm absence of Gr36b transcript

    • Northern blot analysis for transcript detection

  • Functional validation:

    • Electrophysiological recordings from sensilla that normally express Gr36b to confirm loss of response to potential ligands

    • Behavioral assays (e.g., feeding preference tests) to detect changes in taste response

    • Rescue experiments by expressing UAS-Gr36b under control of the appropriate GAL4 driver to restore function

  • Control considerations:

    • Use siblings from the same cross as wild-type controls

    • Create control lines with mutations in non-coding regions to control for off-target effects

How does Gr36b interact with other gustatory receptors to form functional sensory units?

While specific interaction partners of Gr36b are not well-characterized in the provided search results, insights can be drawn from studies of other gustatory receptors. Gustatory receptors in Drosophila often function as heteromeric complexes, with multiple GRs contributing to a functional unit . Based on research on other GRs:

  • Co-expression patterns: Gr36b may be co-expressed with other GRs in the same sensory neurons. Systematic expression analysis using double-labeling experiments with other Gr-GAL4 lines would reveal potential interaction partners.

  • Functional complementation: Similar to the bitter-sensing gustatory receptors that often require Gr66a as a co-receptor , Gr36b might function in combination with other receptors. Functional studies expressing Gr36b alone or in combination with other GRs in heterologous systems or in vivo could identify required co-receptors.

  • Structural interactions: Recent structural studies of GR43a and GR64a revealed that these receptors form tetrameric channels . Each tetramer consists of one central pore domain (PD) and four peripheral ligand-binding domains (LBDs). By analogy, Gr36b likely participates in similar tetrameric arrangements, potentially forming homomeric channels or heteromeric channels with other GRs.

A systematic approach combining co-expression analysis, co-immunoprecipitation, and functional studies would be necessary to fully characterize Gr36b interaction partners.

What role does Gr36b play in Drosophila chemosensory behavior compared to other characterized gustatory receptors?

The specific role of Gr36b in Drosophila chemosensory behavior remains to be fully characterized. To investigate this question, researchers should consider:

  • Behavioral assays:

    • Two-choice feeding preference tests with various tastants

    • Proboscis extension reflex (PER) assays

    • Multi-food choice assays to assess preference hierarchies

    • Oviposition site selection assays for female flies

  • Comparison with known GRs:

    • Sweet-sensing receptors like GR64a respond to disaccharides such as sucrose and maltose

    • Fructose-specific receptor GR43a is activated by monosaccharides

    • Bitter-sensing receptors often require GR66a as a co-receptor

    • Some GRs respond to non-nutritive compounds or toxins

  • Developmental and physiological context:

    • Expression analysis across life stages (larva vs. adult)

    • Response changes under different physiological states (fed vs. starved)

To establish Gr36b's specific role, researchers should perform behavioral assays with Gr36b mutants, analyze neural activation patterns in response to diverse chemical stimuli, and compare these responses to flies with mutations in well-characterized GRs like GR43a, GR64a, and GR66a.

How do the structural characteristics of Gr36b compare to the recently elucidated structures of GR43a and GR64a?

While the specific structure of Gr36b has not been determined, comparative analysis with the recently elucidated structures of GR43a and GR64a can provide insights:

Structural comparison table:

Structural FeatureGR43aGR64aPredicted for Gr36b
Oligomeric stateTetramericTetramericLikely tetrameric
Channel compositionOne central pore domain (PD) with four peripheral ligand-binding domains (LBDs)One central PD with four peripheral LBDsPresumably similar architecture
Ligand specificityMonosaccharide (fructose)Disaccharides (sucrose, maltose)Unknown, requires investigation
Binding pocketNarrow pocket in LBDsLarger, flatter pocket in LBDsTo be determined based on ligand size
Activation mechanismSugar binding induces conformational changes in LBDs that transfer to PDSimilar to GR43aPresumably similar if functioning as ion channel

Based on recent structural studies of GR43a and GR64a , Gr36b likely:

  • Forms tetrameric assemblies with a central ion channel

  • Contains distinct ligand-binding domains that undergo conformational changes upon ligand binding

  • Transduces these conformational changes to open the central ion pore

  • Functions as a non-selective cation channel

Sequence analysis of Gr36b compared to GR43a and GR64a could identify conserved residues involved in channel formation versus divergent residues that might contribute to ligand specificity.

What are the common challenges in expressing and purifying recombinant Gr36b for structural studies?

Expressing and purifying recombinant gustatory receptors, including Gr36b, for structural studies presents several challenges:

  • Expression challenges:

    • Low expression levels typical of membrane proteins

    • Potential toxicity to expression hosts

    • Proper folding and membrane insertion issues

    • Limited stability outside native lipid environment

  • Purification challenges:

    • Detergent selection critical for maintaining structure and function

    • Aggregation during solubilization and purification

    • Low yields after multiple purification steps

    • Maintaining homogeneity for structural studies

Recommendations for optimization:

  • Expression systems:

    • Try various insect cell lines (Sf9, Sf21, High Five)

    • Test mammalian expression systems (HEK293, CHO)

    • Consider cell-free expression systems

  • Construct design:

    • Add fusion tags to improve expression and folding (e.g., MBP, SUMO)

    • Create truncations to remove flexible regions

    • Introduce thermostabilizing mutations

    • Co-express with potential partners if it forms obligate heteromers

  • Purification strategy:

    • Screen multiple detergents (DDM, LMNG, GDN)

    • Use lipid nanodiscs or amphipols for final steps

    • Implement GFP-fusion-based monitoring of membrane localization and folding

The recent successful structural determination of GR43a and GR64a provides a valuable template for approaching Gr36b structural studies .

How can I troubleshoot non-specific binding issues in antibody-based detection methods for Gr36b?

When troubleshooting non-specific binding issues in antibody-based detection methods for Gr36b, consider the following approaches:

  • Antibody selection and validation:

    • Use Gr36b knockout tissues as negative controls

    • Test multiple antibodies targeting different epitopes

    • Consider using epitope-tagged Gr36b constructs (His, FLAG, HA) with well-validated commercial antibodies

    • Validate antibodies with Western blotting before immunohistochemistry

  • Protocol optimization:

    • Increase blocking stringency (5% BSA or 5-10% normal serum from the secondary antibody species)

    • Extend blocking time (overnight at 4°C)

    • Dilute primary antibody further

    • Add competing peptides to block non-specific interactions

    • Include detergents (0.1-0.3% Triton X-100) to reduce hydrophobic interactions

  • Sample preparation improvements:

    • Optimize fixation conditions (duration, temperature)

    • Try different fixatives (4% PFA, Bouin's solution)

    • Perform antigen retrieval if necessary

    • Use fresh tissue samples

  • Detection system considerations:

    • Switch from colorimetric to fluorescent detection for better signal-to-noise ratio

    • Use directly conjugated primary antibodies to eliminate secondary antibody cross-reactivity

    • Consider signal amplification methods (tyramide signal amplification) for low-abundance targets

When validating specificity, remember that Gr36b expression is typically low, as observed with other gustatory receptors, making detection challenging even with specific antibodies .

What strategies can resolve contradictory data between GAL4-based expression patterns and direct detection methods for Gr36b?

Contradictory results between GAL4-based expression patterns and direct detection methods for Gr36b can arise from several factors. Here are strategies to resolve such discrepancies:

  • Validate GAL4 reporter constructs:

    • Ensure the GAL4 construct contains sufficient regulatory elements

    • Create multiple independent insertions and compare expression patterns

    • Use CRISPR/Cas9 to insert GAL4 directly at the Gr36b locus

    • Perform RT-PCR on tissues showing GAL4 activity to confirm endogenous Gr36b expression

  • Improve direct detection methods:

    • Use highly sensitive techniques like RNAscope for low-abundance transcripts

    • Develop and validate multiple antibodies against different Gr36b epitopes

    • Add epitope tags to the endogenous Gr36b using CRISPR/Cas9 genome editing

    • Implement RT-PCR with appropriate controls to detect low-level expression

  • Address methodological limitations:

    • Consider that GAL4 might reflect historical expression rather than current expression

    • Evaluate whether direct detection methods have sufficient sensitivity

    • Assess whether antibodies cross-react with related gustatory receptors

    • Check if in situ hybridization conditions are optimized for low-abundance transcripts

  • Reconciliation approaches:

    • Perform functional studies (calcium imaging, electrophysiology) in tissues where expression is debated

    • Use single-cell RNA sequencing to definitively identify Gr36b-expressing cells

    • Consider that Gr36b might be expressed at different levels across tissues or developmental stages

The literature suggests that discrepancies between detection methods are common for gustatory receptors. For example, Ir51b was detected by RT-PCR in labella and legs but not antennae, despite RNA-seq detection in antennae .

How might computational approaches advance our understanding of Gr36b ligand interactions?

Computational approaches offer powerful tools for predicting and understanding Gr36b ligand interactions:

  • Homology modeling and molecular dynamics:

    • Build 3D models of Gr36b based on recently solved structures of GR43a and GR64a

    • Identify potential ligand-binding pockets through computational pocket detection algorithms

    • Simulate protein dynamics to understand conformational changes upon ligand binding

  • Virtual ligand screening:

    • Perform in silico docking of chemical libraries against the predicted binding pocket

    • Prioritize compounds for experimental validation based on binding energy predictions

    • Use machine learning approaches to identify potential ligands based on physicochemical properties

  • Sequence-based predictions:

    • Analyze conservation patterns across gustatory receptors to identify functional residues

    • Perform evolutionary trace analysis to correlate sequence divergence with ligand specificity

    • Use co-evolution analysis to predict residue interactions important for structure and function

  • Integration with experimental data:

    • Use computational predictions to guide site-directed mutagenesis

    • Verify computational models with experimental structural data when available

    • Refine models iteratively as new experimental data emerges

The recent structural characterization of sugar receptors GR43a and GR64a provides valuable templates for computational studies of Gr36b . Their tetrameric architecture and ligand-binding mechanisms offer a framework for understanding how structural differences in the binding pocket of Gr36b might confer distinct ligand specificity.

What emerging technologies could facilitate high-throughput screening for Gr36b ligands?

Several emerging technologies show promise for high-throughput screening of Gr36b ligands:

  • Cell-based fluorescent assays:

    • Generate stable cell lines expressing Gr36b and calcium indicators (GCaMP)

    • Implement automated fluorescence plate readers for rapid compound screening

    • Develop dual-reporter systems to monitor both receptor expression and activation

  • Microfluidic approaches:

    • Design microfluidic devices for controlled delivery of test compounds

    • Combine with calcium imaging for real-time monitoring of neuronal responses

    • Enable testing of combinatorial chemical mixtures to identify synergistic effects

  • CRISPR-based functional genomics:

    • Create reporter flies with endogenous Gr36b tagged with fluorescent proteins

    • Use in vivo imaging platforms to monitor activation in response to compound libraries

    • Implement optogenetic tools to confirm neuronal circuit involvement

  • Chemical biology methods:

    • Synthesize photoaffinity labeled compound libraries for binding site identification

    • Develop targeted degradation approaches (PROTACs) for temporal control of Gr36b function

    • Implement click chemistry approaches to identify interacting compounds in vivo

  • Integration with computational approaches:

    • Implement machine learning to predict active compounds based on initial screening results

    • Use structure-based virtual screening to prioritize compounds for experimental testing

    • Develop predictive models for structure-activity relationships

The successful application of electrophysiological and calcium imaging methods to characterize sugar sensing by GR43a and GR64a demonstrates the feasibility of adapting these approaches for Gr36b ligand discovery .

How might understanding Gr36b function contribute to broader applications in insect control and comparative sensory biology?

Understanding Gr36b function could contribute to broader applications in several ways:

  • Insect control and agricultural applications:

    • Develop targeted attractants or repellents that interact with Gr36b

    • Design compounds that selectively disrupt chemosensation in pest insects

    • Create species-specific control strategies based on differences in gustatory receptor biology

    • Implement precision integrated pest management through manipulating feeding behavior

  • Comparative sensory biology:

    • Elucidate evolutionary relationships between gustatory receptors across insect species

    • Understand how sensory systems adapt to ecological niches and feeding strategies

    • Compare mechanisms of taste perception between insects and vertebrates

    • Develop models for sensory system evolution and adaptation

  • Biomimetic sensing technologies:

    • Design artificial sensors based on insect gustatory receptor principles

    • Develop bioelectronic interfaces using recombinant gustatory receptors

    • Create highly specific chemical detection systems for environmental monitoring

    • Implement cell-based biosensors for detecting specific compounds

  • Fundamental neuroscience insights:

    • Understand principles of sensory coding and integration

    • Elucidate mechanisms of sensory adaptation and modulation

    • Investigate how gustatory inputs influence behavioral decision-making

    • Study the development and plasticity of chemosensory systems

The recent structural characterization of GR43a and GR64a as tetrameric sugar-gated cation channels provides a foundation for comparative studies with Gr36b, potentially revealing common mechanisms underlying insect chemosensation that could be targeted for various applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.