Recombinant Drosophila melanogaster Putative gustatory receptor 36c (Gr36c)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Properties

Recombinant Drosophila melanogaster Putative Gustatory Receptor 36c (Gr36c) is a protein produced through recombinant DNA technology to study the molecular mechanisms of insect taste perception. Gr36c belongs to the gustatory receptor (GR) family, which mediates chemosensory responses to bitter compounds in Drosophila . Key properties include:

PropertyDetails
Gene NamesGr36c, CG31748, DmelCG31748, Gr36B.3, Gr36B3
Protein NamePutative gustatory receptor 36c
Host SystemsE. coli, yeast, baculovirus, or mammalian cell expression systems
Purity≥85% (determined by SDS-PAGE)
Storage-20°C (short-term); -80°C (long-term)
ApplicationsELISA, Western blot, functional assays

Functional Role in Taste Perception

Gr36c is implicated in bitter compound detection, though its specific ligands remain uncharacterized. Key insights:

  • Bitter Signaling Pathway: Gr36c likely functions in heteromeric complexes with other GRs (e.g., Gr32a, Gr66a) to detect aversive tastants .

  • Neuronal Specificity: Expressed in bitter-sensing gustatory receptor neurons (GRNs), contributing to avoidance behaviors .

Comparative GR Complexes:

Receptor ComplexFunctionReference
Gr32a/Gr59c/Gr66aDetects lobeline, denatonium
Gr22e/Gr32a/Gr66aResponds to strychnine
Gr36c (putative)Unknown ligands; bitter sensing (inferred)

Research Applications

Recombinant Gr36c is critical for:

  • Ligand Identification: Used in cell-based assays to screen for activators/inhibitors .

  • Antibody Production: Rabbit polyclonal antibodies against Gr36c enable protein localization studies .

  • Evolutionary Studies: Comparative analysis of GR diversification across Drosophila species .

Challenges and Future Directions

  • Ligand Specificity: No direct evidence links Gr36c to specific tastants; structural studies are needed .

  • Functional Redundancy: Gr36c may compensate for or suppress other GRs, as observed in Gr59c/Gr32a interactions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gr36c; CG31748; Putative gustatory receptor 36c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr36c
Target Protein Sequence
MDLESFLLGAVYYYGLFIGLSNFEFDWNTGRVFTKKWSTLYAIALDSCIFALYIYHWTGN TNIVNAIFGRANMLHEYVVAILTGLRIVTGLFTLILRWYQRCKMMDLASKVVRMYVARPQ VRRMSRWGILTKFIFGSITDGLQMAMVLSAMGSVDSQFYLGLGLQYWMFVILNMAMMQQH MIMLFVRTQFQLINTELRQVIDEAKDLLLSPRHQGVFMTKCCSLADQIENIARIQSQLQT IMNQMEEVFGIQGAMTYGGYYLSSVGTCYLAYSILKHGYENLSMTLSTVILAYSWCFFYY LDGMLNLSVMLHVQDDYWEMLQILGKRTIFVGLDVRLEEAFENLNLQLIRNPLKITVVKL YDVTRSNTMAMFGNLITHSIFLIQYDIEHF
Uniprot No.

Target Background

Function
This protein is a probable gustatory receptor involved in mediating acceptance or avoidance behavior in Drosophila melanogaster, depending on the specific substrates encountered.
Database Links

KEGG: dme:Dmel_CG31748

STRING: 7227.FBpp0080517

UniGene: Dm.26370

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr22e subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in neurons of the terminal external chemosensory organ of larvae.

Q&A

What is the proper storage protocol for recombinant Drosophila melanogaster Gr36c protein?

The recommended storage protocol for recombinant Gr36c protein involves maintaining it at -20°C for regular storage, while extended preservation requires -20°C to -80°C temperatures . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing cycles should be strictly avoided as they can compromise protein integrity and functionality . For optimal stability, the protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been specifically optimized for this protein . Researchers should document storage conditions in their laboratory notebooks and consider preparing multiple small aliquots during initial receipt to minimize freeze-thaw cycles.

How can researchers verify the structural integrity of recombinant Gr36c before experimental use?

Verification of Gr36c structural integrity involves multiple complementary approaches. Begin with SDS-PAGE analysis to confirm the expected molecular weight (~44 kDa) based on the 390 amino acid sequence . Western blotting using antibodies against the N-terminal 10xHis tag can further confirm identity and integrity . Circular dichroism spectroscopy provides valuable information about secondary structure elements, particularly important for transmembrane proteins like Gr36c. For advanced verification, limited proteolysis followed by mass spectrometry can assess whether the protein maintains its proper folding. These complementary techniques provide a comprehensive assessment of protein quality before proceeding with functional experiments.

How should researchers approach the experimental characterization of Gr36c function?

Characterization of Gr36c function requires a multi-faceted approach beginning with binding assays to identify potential ligands. Since Gr36c is a putative gustatory receptor, calcium imaging in heterologous expression systems can detect receptor activation upon ligand binding. For in vivo relevance, researchers should employ the GAL4/UAS system in Drosophila, as direct in situ hybridization approaches have proven largely unsuccessful due to low expression levels of gustatory receptors . Behavioral assays with wild-type and Gr36c mutant flies, particularly feeding preference tests, can correlate molecular findings with physiological responses. Integration of electrophysiological recordings from gustatory sensilla will provide direct evidence of receptor activation profiles.

How can researchers effectively utilize the GAL4/UAS system to study Gr36c expression patterns in Drosophila?

The GAL4/UAS system represents the gold standard for analyzing Gr expression patterns in Drosophila due to the known limitations of in situ hybridization for these low-abundance transcripts . To implement this approach for Gr36c:

  • Generate Gr36c-GAL4 driver lines by cloning the Gr36c promoter region (typically 1-3kb upstream of the start codon) upstream of GAL4 coding sequence

  • Cross these driver lines with UAS-reporter lines (e.g., UAS-GFP or UAS-RFP)

  • Perform confocal microscopy on resultant progeny to visualize expression patterns

For temporal control, incorporate temperature-sensitive GAL80 (GAL80ts) into the system. This tripartite approach allows for precise spatiotemporal mapping of Gr36c expression. Validate expression patterns using multiple independent driver lines to rule out position effect variegation. To correlate expression with function, combine with optogenetic or thermogenetic effectors (UAS-ChR2 or UAS-TRPA1) for conditional neuronal activation .

What strategies can address the challenges of functional reconstitution of Gr36c in heterologous systems?

Functional reconstitution of transmembrane gustatory receptors like Gr36c presents significant challenges. Researchers should implement a systematic approach:

  • Start with mammalian expression systems (HEK293 or CHO cells) with codon-optimized Gr36c constructs

  • Co-express potential Drosophila co-receptors, as gustatory receptors often function as heteromultimers

  • Incorporate chaperone proteins to facilitate proper folding

  • For membrane reconstitution, utilize nanodiscs or liposomes with Drosophila-like lipid compositions

Monitor receptor functionality through calcium imaging with genetically encoded calcium indicators (GECIs) rather than synthetic dyes. For ligand screening, implement automated microfluidic delivery systems coupled with high-throughput calcium imaging. Failed reconstitution attempts should be systematically documented to identify patterns that might inform future optimization strategies.

How can CRISPR/Cas9 genome editing be optimized for studying Gr36c function in Drosophila?

CRISPR/Cas9 editing offers precise manipulation of Gr36c to investigate its function:

  • Design multiple gRNAs targeting distinct regions of the Gr36c gene using Drosophila-optimized design tools

  • For knockout studies, target early exons to ensure functional disruption

  • For knock-in approaches (adding reporters or tags), design homology-directed repair templates with at least 1kb homology arms

To minimize off-target effects, perform whole-genome sequencing of edited lines. For conditional approaches, combine CRISPR with Flp-FRT or conditional degradation systems. To address genetic redundancy within the gustatory receptor family, consider multiplex CRISPR to target several related receptors simultaneously. Validate all genetic modifications through a combination of sequencing, RT-PCR, and behavioral assays to ensure the desired genomic changes correlate with functional outcomes.

What control experiments are essential when studying recombinant Gr36c function?

Robust experimental design for Gr36c studies requires multiple layers of controls:

  • Protein-level controls: Include denatured Gr36c preparations and related but distinct gustatory receptors (e.g., Gr36a) as negative controls

  • Expression-system controls: Cells expressing vector-only constructs and unrelated transmembrane proteins

  • Genetic controls: Use multiple Gr36c alleles, rescue experiments, and heterozygous controls to confirm phenotype specificity

  • Behavioral controls: Test responses to known attractants/repellents to validate assay functionality

All experiments should incorporate concentration gradients to establish dose-response relationships rather than single-point measurements. Time-course studies can reveal adaptation dynamics essential for understanding gustatory receptor function in vivo. Statistical planning should include power analyses to determine appropriate sample sizes, and blinding procedures to eliminate experimenter bias, particularly for behavioral studies .

What experimental design approach best elucidates the relationship between Gr36c structure and function?

Structure-function relationships for Gr36c require systematic experimental designs that correlate specific protein regions with functional outcomes:

Modification ApproachTarget RegionsReadout MethodExpected Outcome
Alanine scanning mutagenesisTransmembrane domainsCalcium imagingIdentification of ligand-binding residues
Domain swappingN-terminal regionElectrophysiologyDetermining region specificity
Deletion constructsC-terminal tailCellular localizationTrafficking signal identification
Cysteine accessibilityPutative pore regionMTS labelingChannel topology mapping

This systematic approach allows for precise mapping of functional domains within Gr36c. For comprehensive analysis, combine with computational modeling to generate testable hypotheses about structure-function relationships. All mutation studies should be validated with proper expression controls to ensure observed effects are not due to protein misfolding or degradation .

How should researchers design experiments to identify ligands for Gr36c?

Ligand identification for orphan receptors like Gr36c requires a multi-tiered experimental design:

  • Begin with computational ligand prediction based on sequence similarity to characterized gustatory receptors

  • Implement moderate-throughput screening using heterologous expression systems with calcium imaging readouts

  • Validate candidate ligands through dose-response analyses and competitive binding assays

  • Confirm physiological relevance using behavioral assays in wild-type versus Gr36c mutant flies

For comprehensive coverage, screen ecologically relevant compounds based on Drosophila's natural diet and environment. Consider temporal factors, as gustatory responses may involve adaptation or sensitization. Implement internal standards and reference compounds with known effects on other gustatory receptors to calibrate assay sensitivity. Document all tested compounds, including negative results, to build a comprehensive profile of Gr36c ligand specificity .

How should researchers address contradictory results in Gr36c functional studies?

Contradictory results in Gr36c research require systematic troubleshooting:

  • Evaluate protein quality across studies using standardized assays to ensure comparable starting material

  • Assess expression levels, as both overexpression and insufficient expression can lead to artifacts

  • Compare experimental conditions including buffer composition, temperature, and pH

  • Consider genetic background effects in Drosophila studies, particularly when comparing lab strains

When contradictions persist, design critical experiments that directly test competing hypotheses. Implement multivariate analysis to identify potential confounding variables. Consider collaborations with laboratories reporting different results to perform side-by-side experiments with standardized protocols. Document methodological differences comprehensively in publications to facilitate troubleshooting by the broader research community .

What statistical approaches are most appropriate for analyzing Gr36c expression and function data?

Statistical analysis for Gr36c studies should be tailored to the specific experimental approach:

  • For expression pattern analysis, use quantitative image analysis with appropriate normalization to reference regions

  • For dose-response relationships, employ nonlinear regression to determine EC50/IC50 values

  • For behavioral data, consider non-parametric tests when normality cannot be assumed

  • For transcriptomic studies, implement multiple-testing correction to control false discovery rates

How can researchers integrate Gr36c findings with broader knowledge of gustatory receptor function?

Integration of Gr36c research within the broader gustatory receptor field requires:

  • Systematic comparison with related gustatory receptors, particularly those in the same phylogenetic clade

  • Analysis of co-expression patterns to identify potential heteromeric partnerships

  • Correlation of molecular findings with anatomical and circuit-level insights

  • Consideration of evolutionary context through comparative studies in related Drosophila species

Create comprehensive data tables that compare properties across gustatory receptor family members. Consider development of standardized assays that allow direct comparison between different receptors. Implement data visualization approaches that highlight both similarities and differences between Gr36c and other family members. Contribute to community databases and research consortia to facilitate integration of findings across research groups .

What are the most promising future research directions for Gr36c studies?

The field of Gr36c research presents several high-potential avenues for future investigation:

  • Structural biology approaches: Cryo-EM or X-ray crystallography studies to determine three-dimensional structure

  • Circuit mapping: Connectomics approaches to identify the neural circuits in which Gr36c-expressing neurons participate

  • Ecological relevance: Field studies connecting Gr36c function to feeding behavior and survival in natural environments

  • Translational applications: Potential use of Gr36c knowledge for developing novel insect control strategies

Methodological advances in single-cell transcriptomics could reveal previously unrecognized cell populations expressing Gr36c. Development of more sensitive functional assays may uncover subtle phenotypes missed by current approaches. Cross-disciplinary collaborations, particularly with computational biologists and structural chemists, will be essential for comprehensive understanding of this complex transmembrane receptor .

How can researchers effectively document and share Gr36c protocols to advance the field?

Advancement of Gr36c research requires effective knowledge sharing:

  • Publish detailed protocols with troubleshooting guides in protocol-specific journals

  • Deposit plasmids, antibodies, and fly lines in public repositories with clear documentation

  • Implement open science practices including pre-registration of studies and data sharing

  • Create standardized reporting templates for key experimental parameters

Consider developing community consensus on minimal reporting standards for Gr36c studies. Participate in collaborative validation studies to test reproducibility of key findings. Maintain living protocols in platforms like protocols.io that can be updated as methodologies evolve. Engage with broader Drosophila and sensory biology communities to facilitate cross-pollination of ideas and approaches .

What training resources are available for new researchers entering the Gr36c field?

Researchers new to Gr36c studies can access various training resources:

  • Online courses in Drosophila genetics and molecular biology through platforms like Coursera and edX

  • Workshops and practical courses offered by organizations like EMBO and Cold Spring Harbor Laboratory

  • Community resources including FlyBase and the Bloomington Drosophila Stock Center

  • Method-specific training through core facilities specializing in protein expression and purification

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.