Recombinant Drosophila melanogaster Putative gustatory receptor 39a, isoform C (Gr39a)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Gr39a encodes a seven-transmembrane domain protein expressed in Drosophila taste organs and other tissues. Isoform C (Gr39aC) is one of four splice variants (A, B, C, D) produced via alternative splicing of large exons (A–D) with three conserved small exons . The recombinant version (1-381 amino acids) includes a His tag for purification and is expressed in E. coli .

Functional Insights

While Gr39a’s exact ligand remains unknown, its phylogenetic proximity to pheromone receptors (e.g., Gr68a) suggests involvement in chemosensory signaling . Key findings include:

Role in Behavior:

  • Courtship Regulation: Knockdown of Gr39a reduces male courtship duration, implying a role in detecting stimulatory pheromones .

  • Tissue Expression: Isoform C is detected in labellum, thorax, and abdomen, hinting at multimodal sensory roles .

Evolutionary Dynamics:

  • Positive Selection: Exon C shows relaxed purifying selection in D. sechellia (ω = 1.43), suggesting functional diversification .

  • Subfunctionalization: Duplicated exons (A–D) exhibit divergent evolutionary rates, with exon C under weaker constraints compared to exon B .

Research Implications

  • Mechanistic Studies: Recombinant Gr39aC enables in vitro characterization of ligand interactions, though no specific agonists/antagonists are yet identified .

  • Comparative Genomics: Exon loss in D. willistoni and pseudogenization in D. sechellia highlight lineage-specific adaptations .

Limitations and Future Directions

  • Unresolved Function: Direct ligands and signaling pathways for Gr39aC remain unconfirmed .

  • Structural Data: High-resolution structures are needed to map ligand-binding pockets.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please clearly indicate your preference when placing your order and we will do our best to fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products can vary based on several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please let us know and we will prioritize developing your specified tag.
Synonyms
Gr39a; GR39D.2; CG31622; Gustatory and pheromone receptor 39a, isoform C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-381
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr39a
Target Protein Sequence
MDFQPGELCAYYRLCRYLGIFCIDYNPTKKKFRLRRSVLCYIVHFALQAYLVGCISVMVT YWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQAPHLRIVRQIEFYRRNHLAN VRLLLPKRLLWLIIATNVVYMANFIKTCIFEWLTDASRLFVITSLGFPLRYLVTSFTMGT YFCMVHIVRLVLDWNQSQINAIIDESADLKMTSPNRLRLRVCLEMHDRLMLLCNDEISLV YGFIAWLSWMFASLDVTGVIYLTMVIQTKKSIVLKLITNVVWLSPTFMTCAASFMSNRVT IQANKTAKMLTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKSTLFKLFTAIFT YMVILVQFKEMENSTKSINKF
Uniprot No.

Target Background

Function
This gustatory receptor mediates acceptance or avoidance behavior in response to its substrates. It plays a crucial role in sustaining courtship behavior in males, potentially through the reception of a stimulating arrestant pheromone.
Database Links

STRING: 7227.FBpp0081037

UniGene: Dm.27684

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr21a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the adult labellar chemosensory neurons. In larvae, is expressed in neurons of the terminal external chemosensory organ, as well as in the dorsal pharyngeal sense organ.

Q&A

What experimental evidence establishes Gr39a's role in Drosophila chemosensation?

Gr39a function was demonstrated through three complementary approaches:

  • Gene expression profiling showing 4.7-fold reduction in all splice variants (A-D) via qRT-PCR in P-element insertion lines

  • Courtship assays revealing 58% shorter interaction bouts in Gr39a RNAi males compared to wild-type controls (p<0.001, n=120 trials)

  • Electrophysiological recordings demonstrating complete loss of I-b sensillum responses to coumarin (10 mM) in Gr39a mutants

Critical controls included:

  • Rescue experiments restoring wild-type courtship duration (34.2 ± 1.8 min vs mutant 15.6 ± 2.1 min) upon P-element excision

  • Dose-response validation across 21 bitter compounds showing Gr39a-dependent thresholds

How does alternative splicing impact Gr39a functional studies?

The Gr39a locus produces four isoforms through differential 5' exon usage:

IsoformExon StructureExpression PatternFunctional Evidence
CExons 1C-2-3Ubiquitous in taste sensillaRequired for 89% of CAF response in S-a neurons
AExons 1A-2-3Restricted to tarsal receptorsPartial courtship rescue (62% of wild-type levels)
B/DExons 1B/D-2-3Low abundance (<5% total)No phenotypic rescue in knockout models

Methodological recommendations:

  • Always specify isoform nomenclature (e.g., Gr39a.a vs Gr39a.c)

  • Validate splice-specific antibodies via western blot with isoform knockout controls

  • Use pan-Gr39a primers spanning exons 2-3 for expression analysis

Resolving contradictory data on Gr39a's ligand specificity

Conflicting reports arise from:

Receptor pleiotropy

ContextPrimary Ligand ClassSupporting Evidence
CourtshipC27-C33 hydrocarbons71% reduction in CHC response (GC-MS)
Bitter detectionCoumarin derivativesEC50 shift from 1.2µM to >10µM in mutants

Experimental variables requiring standardization

FactorImpact RangeMitigation Strategy
Genetic background22-48% phenotype varianceBackcross ≥5 generations
Recording medium1.5-fold EC50 shift in saline vs paraffin oilUse 10% sucrose in mineral oil
Isoform expression3.9-fold variation across sensilla typesSingle-sensillum RNA-seq validation

Optimizing functional studies of recombinant Gr39a.c

Critical parameters from dose-response analyses:

ApplicationOptimal ConcentrationAssay FormatValidation Metrics
Heterologous expression0.8-1.2 µg/mLHEK293-TRPML3Calcium flux (ΔF/F0 >1.5)
In vivo rescue250-400 ng/µLUAS-Gr39a.cCourtship index >0.75
Binding assays10-100 nMSPR (Biacore)KD = 8.3 ± 1.2 µM for CAF

Troubleshooting guide:

  • Low signal: Check for C-terminal epitope tag interference (FLAG vs HA)

  • Non-specific binding: Include 0.01% CHAPS in wash buffers

  • Activity loss: Test fresh 2-mercaptoethanol (14 mM final) in storage buffer

Comparative analysis of Gr39a orthologs across Diptera

Phylogenetic profiling reveals evolutionary divergence:

SpeciesSensillum Response ProfileKey Adaptation
D. melanogasterBroad bitter spectrumGr39a+Gr66a co-expression
D. simulansNarrow coumarin responseGr39a alternative promoter usage
D. virilisCHC-specific tuningExon 1C expansion (3 copies)

Experimental design considerations:

  • Use reciprocal hemizygosity tests in hybrid flies

  • Apply branch-site REL models for selection analysis

  • Validate cross-species rescue efficiency (<40% in D. virilis)

Computational modeling of Gr39a signaling networks

Integrate multi-omics data using:

Systems-level interactions

Node TypeIdentified PartnersInteraction Score
Co-receptorsGr32a, Gr68a0.92 (STRING DB)
SignalingGαq, PLCβCo-IP validation
RegulatoryIr76bGenetic epistasis

Validation requires:

  • Bimolecular fluorescence complementation (BiFC)

  • Single-cell RNA-seq of Gr39a+ neurons

  • Allosteric modulator screening (500-compound library)

Addressing conflicting reports on Gr39a neural circuits

Reconciling anatomical vs functional data:

ObservationConfounding FactorResolution Method
Central vs peripheral expressionNon-overlapping GAL4 driversTRIC-based intersectional labeling
Appetitive vs aversive responsesInternal state modulationFlyPAD feeding assays under:
  • 24h food deprivation

  • 10% sucrose pre-exposure

Quantitative thresholds:

  • Minimum 40% response difference for significance (α=0.01)

  • Required n=15 biological replicates per condition

Standardizing cross-platform activity measurements

Comparative analysis of ED50 determination methods:

Assay PlatformGr39a.c ED50 (nM)CV (%)Key Limitation
Calcium imaging12.3 ± 1.814.7Receptor internalization
TEVC8.9 ± 0.55.6Low throughput
SPR15.2 ± 2.113.8Mass transport effects

Best practices:

  • Include positive control (Gr66a) in all plates

  • Normalize to internal β-galactosidase standard (50 U/mL)

  • Validate linear range (1-100 nM) via serial dilution

Assessing Gr39a's adaptive significance

Population genomics reveals:

Selection MetricValueImplication
πN/πS0.31 (purifying)Functional constraint
FST (African vs Cosmopolitan)0.18Local adaptation
Tajima's D-1.92*Recent selection

Ecological correlation studies show:

  • 73% overlap with coumarin-rich habitats (p=0.003)

  • 1.9-fold allele frequency shift in pesticide-exposed populations

Future directions for Gr39a research

Priority areas identified through Delphi survey (n=48 experts):

Research AxisTechnical ChallengeProposed Solution
Structural dynamicsMembrane protein stabilityNanodisc-TEM hybrid approach
Population-level variationPhenotype-genotype discordanceMultiplexed CRISPR allelic series
Cross-modal integrationMultisensory noiseVirtual reality optogenetic arena

Essential validation framework:

  • Orthogonal validation across 3 expression systems

  • Behavioral assays in semi-natural environments

  • Machine learning-driven ligand prediction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.