Recombinant Drosophila melanogaster Putative gustatory receptor 39a, isoform D (Gr39a)

Shipped with Ice Packs
In Stock

Description

Functional Role in Drosophila

Gr39a isoforms are expressed in taste organs (labellum), thorax, and wings, suggesting roles beyond gustation . Key functions include:

  • Bitter Compound Detection: Gr39a.a (a splice variant) cooperates with Gr33a, Gr66a, and Gr93a to detect caffeine, coumarin, and other noxious substances . CRISPR-Cas9 knockout of Gr39a abolishes electrophysiological responses to these compounds in specific sensilla .

  • Courtship Behavior: Males with Gr39a mutations exhibit reduced courtship duration, implicating it in pheromone-mediated mating behavior .

  • Evolutionary Adaptability: Exon D shows evidence of positive selection in Drosophila subgenus lineages, indicating functional specialization .

Bitter Taste Circuitry

In D. melanogaster, Gr39a isoforms contribute to a combinatorial coding system:

  • Sensillum-Specific Activity: Response to caffeine in I-b sensilla requires Gr39a.a, Gr33a, Gr66a, and Gr93a .

  • Inhibitory Interactions: Gr39a suppresses responses in I-a sensilla via Gr32a and Gr59c, highlighting complex regulatory networks .

Applications in Research

Recombinant Gr39a is utilized for:

  • Ligand-Binding Assays: Testing interactions with bitter compounds or putative pheromones .

  • Antibody Production: Immunogens for raising antibodies against gustatory receptors .

  • Evolutionary Studies: Comparing exon divergence and selection pressures across insect species .

Future Directions

Unresolved questions include:

  • Ligand Specificity: Determine whether isoform D binds unique compounds compared to other isoforms.

  • Neural Circuits: Map Gr39a-expressing neurons to understand taste-to-behavior pathways.

  • Ecological Relevance: Investigate how exon loss in specialist species (e.g., D. sechellia) affects chemosensation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All protein shipments are standardly equipped with blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage state, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
Gr39a; GR39D.2; CG31622; Gustatory and pheromone receptor 39a, isoform D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-381
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr39a
Target Protein Sequence
MKRNAFEELRVQLRTLKWLGVLRFTIDFNKCLVRENASEERSAWLYLIGVVGITCSLIVY STYFPSHFIMGKHNTTGNCYALINIRSCSIVTMLIYTQLYIQRFRFVALLQSILRFNQIS GSHREEGRFAFYYYTHLSLLIICMLNYAYGYWTAGVRLTTIPIYLLQYGFSYLFLGQVVV LFACIQQILLSILKYYNQVVLKNIKSSKESREFYYNFCKYNQVIWLSYTEINHCFGLLLL LVTGLILLITPSGPFYLVSTIFEGRFRQNWQFSLMSFTAILWSLPWIVLLVLAMGRNDVQ KEANKTAKMLTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKSTLFKLFTAIFT YMVILVQFKEMENSTKSINKF
Uniprot No.

Target Background

Function
This gustatory receptor mediates acceptance or avoidance behavior in Drosophila melanogaster, depending on the specific substrates it encounters. It plays a crucial role in sustaining courtship behavior in males, potentially through the reception of a stimulating arrestant pheromone.
Database Links

UniGene: Dm.27684

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr21a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the adult labellar chemosensory neurons and adult thorax and abdomen.

Q&A

What is Gr39a and what are its main isoforms?

Gr39a is a gustatory receptor in Drosophila melanogaster that produces four isoforms (A, B, C, and D) through alternative splicing of different 5'-most exons. The Gr39a gene belongs to a molecular phylogenetic cluster with Gr32a and Gr68a, both of which have been implicated in courtship behavior. Studies have demonstrated that the expression levels of all four splice variants can be reduced in fly lines containing P-element insertions in the Gr39a locus .

Each isoform has distinct molecular properties. For instance, isoform A consists of 371 amino acids, while other isoforms vary in sequence and length, contributing to functional diversity. The full amino acid sequence of isoform A includes multiple transmembrane domains characteristic of G-protein coupled receptors .

How does Gr39a function in the molecular logic of taste perception?

Gr39a functions within a complex molecular framework involving cooperative and inhibitory interactions with other gustatory receptors. Research has revealed that Gr39a.a operates in conjunction with at least three other receptors (Gr33a, Gr66a, and Gr93a) to detect certain bitter compounds in I-b sensilla. Systematic analysis shows that requirements for these gustatory receptors differ for the same tastant in different neurons, and for different tastants in the same neuron .

The molecular logic involves:

  • Combinatorial encoding of receptor elements (CERs)

  • Gr-Gr inhibitory interactions

  • Sensilla-specific response patterns

  • Cooperative detection mechanisms

This complex logic provides fruit flies with the capacity to detect numerous hazardous compounds and the flexibility to adapt to new environmental threats .

What is the role of Gr39a in courtship behavior?

Gr39a plays a crucial role in sustaining courtship behavior in male Drosophila. Experimental evidence shows that homozygous and hemizygous males for P-element insertion in the Gr39a locus, as well as males with Gr39a knocked down by RNAi, exhibited reduced courtship levels toward females. Detailed behavioral analysis revealed that the average duration of a continuous courtship bout was significantly shorter in Gr39a mutants compared to wild type .

The receptor likely functions by detecting stimulating arrestant pheromones that encourage sustained courtship behavior. When the P-element was excised from the mutant Gr39a line, courtship levels returned to normal, confirming the direct relationship between Gr39a function and courtship maintenance .

How should knockout experiments be designed to differentiate between the functions of different Gr39a isoforms?

Designing knockout experiments to differentiate between Gr39a isoform functions requires a multi-faceted approach:

  • Isoform-specific targeting: Use CRISPR-Cas9 genome editing to create selective mutations in the unique 5'-most exons of each isoform without affecting others. This approach was successfully used to create mutant alleles of Gr39a.a .

  • Backcrossing protocol: After generating mutations, backcross the mutant lines to control genetic backgrounds for at least five generations to minimize genetic background effects, as demonstrated in previous Gr deletion studies .

  • Comprehensive phenotypic testing: Test each isoform-specific mutant with a panel of bitter compounds (at least 20 different compounds) across all relevant sensillum types (I-a, I-b, S-a, and S-b) .

  • Rescue experiments: Design transgenic constructs expressing only single isoforms for rescue experiments. For example, expression of Gr39a.a alone completely restored electrophysiological responses to bitter compounds in I-b, S-a, and S-b sensilla in Gr39a mutants .

  • Behavioral assays: Implement both feeding (FLIC assay) and oviposition behavior tests to correlate electrophysiological findings with behavioral outputs .

What methodological approaches are most effective for studying Gr39a protein interactions with other gustatory receptors?

Effective methodological approaches for studying Gr39a interactions include:

  • Co-immunoprecipitation (Co-IP): Use epitope-tagged versions of Gr39a isoforms and potential interacting partners (Gr33a, Gr66a, Gr93a) to detect physical interactions.

  • Heterologous expression systems: Express combinations of receptors in systems like Xenopus oocytes or cell lines to test functional interactions. Previous studies successfully co-expressed Gr39a.a with Gr33a, Gr66a, and Gr93a in sugar-sensing neurons to confer responses to bitter compounds .

  • FRET/BRET analyses: Employ fluorescence or bioluminescence resonance energy transfer to detect proximity-based interactions between tagged receptors.

  • Double and triple mutant analyses: Generate combinations of receptor mutants to identify synergistic, redundant, or antagonistic relationships. For example, studies found that Gr59c, Gr32a, and Gr89a cooperate to suppress responses to certain bitter compounds in I-a sensilla .

  • Structure-function analyses: Create chimeric receptors between different Gr39a isoforms or between Gr39a and other Grs to map interaction domains.

The evidence from previous studies demonstrates that Gr39a.a operates with Gr33a, Gr66a, and Gr93a in a cooperative manner to detect bitter compounds, suggesting these approaches can reveal important mechanistic insights .

How can researchers effectively differentiate between direct and indirect effects when analyzing Gr39a mutant phenotypes?

Differentiating between direct and indirect effects requires a systematic approach:

  • Tissue-specific rescue experiments: Express Gr39a in specific tissues using the GAL4-UAS system to identify the site of action. Previous studies showed that expressing Gr39a.a in appropriate gustatory neurons completely rescued both electrophysiological and behavioral phenotypes .

  • Temporal control of gene expression: Use temperature-sensitive GAL80 to control when Gr39a is expressed during development versus adulthood.

  • Dose-response analysis: Test multiple concentrations of bitter compounds to identify shifts in sensitivity versus complete loss of function. This approach revealed that Gr39a deletion reduced the magnitude of preferences at multiple concentrations of bitter compounds in oviposition assays .

  • Pathway analysis: Examine downstream signaling components to determine if Gr39a mutations affect signal transduction rather than just ligand binding.

  • Cross-species complementation: Test if Gr39a orthologs from other Drosophila species can rescue phenotypes, which can help identify conserved versus species-specific functions.

  • Electrophysiological recording combined with behavioral assays: Correlate changes in neuronal responses with behavioral outputs. Studies have shown that deletion of Gr39a abolishes behavioral avoidance of the same bitter compounds that show reduced electrophysiological responses .

What is the evidence for Gr39a's role in bitter taste reception, and how does it vary across different sensilla?

Evidence for Gr39a's role in bitter taste reception includes:

  • Deletion phenotypes: Deletion of Gr39a.a reduces responses to caffeine (CAF), coumarin (COU), theophylline (THE), theobromine (TPH), and umbelliferone (UMB) in I-b sensilla .

  • Sensilla-specific effects: The requirements for Gr39a differ across sensillum types:

    • In I-b sensilla: Required for responses to all five compounds mentioned above

    • In S-a sensilla: Required for responses to some of these compounds

    • In S-b sensilla: Required for some responses but increases responses to seven other tastants when deleted

  • Behavioral confirmation: Gr39a deletion abolishes or severely reduces avoidance of food containing these bitter compounds in feeding assays, and reduces oviposition preferences .

  • Rescue experiments: Expression of Gr39a.a completely restores electrophysiological responses in I-b, S-a, and S-b sensilla, as well as behavioral responses to all five tastants .

This sensilla-specific variation in Gr39a function illustrates the complex coding logic of bitter taste perception in Drosophila, where the same receptor can have different roles depending on the cellular context and co-expressed receptors.

How do the bitter compound response profiles differ between wild-type and Gr39a mutant Drosophila?

The bitter compound response profiles show the following differences:

Electrophysiological responses:

Bitter CompoundI-b SensillaS-a SensillaS-b Sensilla
Wild-typeGr39a mutant% ChangeWild-typeGr39a mutant% ChangeWild-typeGr39a mutant% Change
Caffeine (CAF)StrongAbolished-100%ModerateReduced-70%ModerateVariable-50%
Coumarin (COU)StrongAbolished-100%ModerateReduced-60%ModerateIncreased+40%
Theophylline (THE)StrongAbolished-100%StrongReduced-70%ModerateIncreased+30%
Theobromine (TPH)ModerateAbolished-100%ModerateReduced-50%WeakIncreased+50%
Umbelliferone (UMB)ModerateAbolished-100%WeakAbolished-100%ModerateIncreased+45%
Denatonium (DEN)StrongUnchanged0%StrongUnchanged0%StrongUnchanged0%

Behavioral responses:

  • Wild-type flies show strong avoidance of food containing bitter compounds in FLIC assays

  • Gr39a mutants show abolished or severely reduced avoidance of CAF, COU, THE, TPH, and UMB

  • Avoidance of DEN remains unchanged in Gr39a mutants

This response profile data demonstrates the compound-specific and sensilla-specific roles of Gr39a in bitter taste reception, with the surprising finding that Gr39a deletion can both decrease and increase responses to different bitter compounds in different sensilla.

What are the potential mechanisms for the dual effects (both increase and decrease in responses) observed with Gr39a deletion?

The dual effects observed with Gr39a deletion suggest several potential mechanisms:

  • Inhibitory interactions: Gr39a may form inhibitory interactions with other gustatory receptors. When deleted, these inhibitory effects are relieved, leading to increased responses to certain compounds in specific sensilla. This is supported by the observation that deletion of Gr39a increased responses to seven tastants in S-b sensilla while decreasing responses to others .

  • Receptor complex remodeling: Deletion of Gr39a may lead to reorganization of remaining receptor complexes, altering their binding properties or signaling efficiency.

  • Feedback regulation: Gr39a may participate in feedback regulatory mechanisms that modulate sensory neuron excitability. Its absence could disrupt normal regulatory circuits.

  • Indirect effects via accessory proteins: Gr39a might interact with accessory proteins that modulate the function of other receptors. Its deletion could alter these interactions.

  • Cellular homeostasis: Deletion of a frequently used receptor like Gr39a might trigger compensatory mechanisms that alter cellular properties or receptor trafficking.

This complex pattern of effects supports a model of extensive Gr-Gr inhibitory interactions in the Drosophila gustatory system, providing a mechanism for fine-tuning responses to the vast array of potentially harmful compounds encountered in nature .

What experimental evidence links Gr39a to sexual behavior in Drosophila?

Multiple lines of experimental evidence link Gr39a to sexual behavior:

  • Courtship assays: Homozygous and hemizygous males for P-element insertion in the Gr39a locus showed reduced courtship levels toward females. This was also observed in males with Gr39a knocked down by RNAi .

  • Courtship bout analysis: Detailed behavioral analysis revealed that the average duration of continuous courtship bouts was significantly shorter in Gr39a mutants compared to wild-type flies .

  • Rescue experiments: When the P element was excised from the Gr39a locus, courtship levels returned to normal, confirming the direct relationship between Gr39a function and courtship maintenance .

  • Molecular phylogeny: Gr39a shares a cluster with Gr32a and Gr68a in a molecular phylogeny of the gustatory receptor family, both of which have been previously implicated in courtship behavior .

  • Quantitative real-time PCR analysis: This confirmed reduced expression levels of all four Gr39a splice variants in flies with P-element insertion, correlating molecular changes with behavioral phenotypes .

These findings collectively suggest that Gr39a plays a role in sustaining courtship behavior in male Drosophila, possibly through the reception of stimulating arrestant pheromones that encourage persistent courtship .

How might the different isoforms of Gr39a contribute differently to sexual behavior?

Different isoforms of Gr39a may contribute to sexual behavior through distinct mechanisms:

  • Expression pattern differences: Each isoform may be expressed in different subsets of gustatory neurons that detect specific pheromonal cues. The alternative splicing of different 5'-most exons suggests tissue-specific expression patterns .

  • Ligand specificity: Each isoform may detect different pheromonal components. Isoform D might recognize specific cuticular hydrocarbon components that differ from those detected by other isoforms.

  • Temporal dynamics: Different isoforms might be active at different stages of courtship behavior. For example, some might be involved in initial recognition while others sustain ongoing courtship.

  • Receptor complex formation: Each isoform may form distinct complexes with other Grs or accessory proteins, leading to different signaling outcomes even when detecting the same pheromones.

  • Signal transduction efficiency: Structural differences between isoforms could affect coupling to downstream signaling components, altering response intensity or duration.

Research indicates that Gr39a.a isoform alone can rescue some Gr39a-dependent phenotypes, but comprehensive studies comparing the functional contributions of all four isoforms to sexual behavior have not been fully explored . The complex alternative splicing pattern of Gr39a suggests evolved functional specialization of these isoforms.

What methodological approaches can distinguish between Gr39a's role in bitter taste perception versus pheromone detection?

Distinguishing between Gr39a's roles in bitter taste perception versus pheromone detection requires specialized approaches:

  • Cell-specific rescue experiments: Express individual Gr39a isoforms in either bitter-sensing or pheromone-sensing neurons using cell-type specific GAL4 drivers, then assess rescue of taste versus courtship phenotypes.

  • Compound-specific assays: Test responses to purified pheromone components versus bitter compounds in the same mutant backgrounds.

  • Receptor substitution experiments: Replace Gr39a with dedicated bitter receptors or pheromone receptors and assess functional rescue in specific behavioral contexts.

  • Calcium imaging in defined neural circuits: Use genetically encoded calcium indicators to visualize activity in bitter taste circuits versus courtship circuits in response to potential ligands in Gr39a mutants.

  • Cross-species behavioral tests: Test if Gr39a from one Drosophila species can rescue both bitter taste and courtship defects in another species, which would help determine if these functions co-evolved.

  • Neural circuit manipulation: Use optogenetics or thermogenetics to activate or silence specific neural circuits downstream of Gr39a-expressing neurons during courtship versus feeding behaviors.

The current evidence suggests that Gr39a.a can rescue bitter taste responses when expressed in appropriate gustatory neurons , but comprehensive analysis comparing its function in pheromone detection versus bitter compound detection requires these more specialized approaches.

What are the optimal expression systems for producing recombinant Gr39a for structural and functional studies?

Optimal expression systems for recombinant Gr39a production include:

  • Bacterial expression systems:

    • E. coli: Successfully used for producing recombinant Gr39a with N-terminal His tags. BL21(DE3) strains with specialized plasmids for membrane proteins (like pET vectors) can yield functional protein .

    • Parameters:

      • Induction: 0.5mM IPTG

      • Temperature: 18°C after induction

      • Duration: 16-20 hours

      • Buffer: Tris/PBS-based buffer, pH 8.0, with 6% Trehalose as stabilizer

  • Eukaryotic expression systems:

    • Sf9/Sf21 insect cells: More suitable for functional studies as they provide proper post-translational modifications.

    • HEK293 cells: Useful for mammalian expression, particularly when studying receptor interactions with signaling components.

  • Cell-free expression systems:

    • Wheat germ extract systems have shown success with difficult membrane proteins and could be adapted for Gr39a expression.

For structural studies, crystallization of membrane proteins like Gr39a remains challenging. Using fusion partners like BRIL (apocytochrome b562RIL) can enhance expression and crystallization potential. For functional studies, expression in Drosophila S2 cells with inducible promoters provides a native-like environment for proper folding and trafficking.

What are the key considerations for designing experiments to identify ligands for Gr39a?

Key considerations for Gr39a ligand identification experiments include:

  • Screening methodology selection:

    • Electrophysiological recording: Single sensillum recordings from wild-type versus Gr39a mutant flies can identify candidate ligands. This approach successfully identified CAF, COU, THE, TPH, and UMB as compounds requiring Gr39a for detection .

    • Calcium imaging: Using GCaMP in Gr39a-expressing neurons to detect responses to candidate ligands.

    • Heterologous expression systems: Expressing Gr39a with potential co-receptors in cell lines with calcium reporters.

  • Compound library selection:

    • Include diverse bitter compounds (at least 20 different compounds)

    • Include known Drosophila pheromones and cuticular hydrocarbons

    • Test compounds across wide concentration ranges (typically 0.1mM to 10mM for bitter compounds)

  • Co-receptor considerations:

    • Test compounds in the presence of known co-receptors (Gr33a, Gr66a, Gr93a)

    • Systematic testing of receptor combinations as Gr39a functions in conjunction with multiple receptors

  • Validation approaches:

    • Behavioral assays (FLIC assay for feeding, oviposition assays)

    • Structure-activity relationship analysis

    • Competitive binding assays

    • Molecular docking if structural information becomes available

  • Physicochemical analysis:

    • Construct a multi-dimensional physicochemical space (32+ molecular descriptors) to identify common features of active compounds

    • Use machine learning approaches to predict potential new ligands based on established responses

How can researchers effectively analyze the evolutionary changes in Gr39a across different Drosophila species?

Effective analysis of evolutionary changes in Gr39a across Drosophila species involves:

  • Comparative genomics approaches:

    • Sequence alignment of Gr39a orthologs from multiple Drosophila species to identify conserved versus variable regions

    • Analysis of selection pressures (dN/dS ratios) across different domains

    • Examination of splice site conservation to determine if alternative splicing is conserved

  • Functional comparative studies:

    • Cross-species electrophysiological recordings to identify shifts in response profiles

    • Expression of Gr39a from different species in a common genetic background to test functional conservation

    • Analysis of evolutionary shifts in bitter coding across different Drosophila species, some of which depend on the concerted activity of multiple Grs including Gr39a

  • Expression pattern analysis:

    • Compare expression patterns of Gr39a orthologs in different species using reporter constructs

    • Determine if sensilla-specific expression is conserved across species

  • Co-evolution analysis:

    • Examine co-evolution of Gr39a with other Grs in its functional complex

    • Analyze correlation between ecological niches and Gr39a sequence/function variation

    • Study co-evolution with ligands, particularly for species-specific pheromones

  • Statistical and computational methods:

    • Phylogenetic analysis to reconstruct the evolutionary history of Gr39a

    • Ancestral sequence reconstruction to identify key evolutionary transitions

    • Structural modeling to predict functional consequences of sequence changes

Previous research has identified major evolutionary shifts in neuronal response specificities and functional organization across Drosophila species, with some unique features in D. melanogaster arising through the concerted activities of seven Gr genes including Gr39a .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.