Recombinant Drosophila melanogaster Putative gustatory receptor 58a (Gr58a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gr58a; GR58A.1; CG30396; Putative gustatory receptor 58a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-395
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr58a
Target Protein Sequence
MLLKFMYIYGIGCGLMPAPLKKGQFLLGYKQRWYLIYTACLHGGLLTVLPFTFPHYMYDD SYMSSNPVLKWTFNLTNITRIMAMFSGVLLMWFRRKRILNLGENLILHCLKCKTLDNRSK KYSKLRKRVRNVLFQMLLVANLSILLGALILFRIHSVQRISKTAMIVAHITQFIYVVFMM TGICVILLVLHWQSERLQIALKDLCSFLNHEERNSLTLSENKANRSLGKLAKLFKLFAEN QRLVREVFRTFDLPIALLLLKMFVTNVNLVYHGVQFGNDTIETSSYTRIVGQWVVISHYW SAVLLMNVVDDVTRRSDLKMGDLLREFSHLELVKRDFHLQLELFSDHLRCHPSTYKVCGL FIFNKQTSLAYFFYVLVQVLVLVQFDLKNKVEKRN
Uniprot No.

Target Background

Function
This protein is a putative gustatory receptor that likely mediates acceptance or avoidance behavior, depending on its substrates.
Database Links

KEGG: dme:Dmel_CG30396

STRING: 7227.FBpp0071644

UniGene: Dm.26351

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr22e subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the adult labellar chemosensory neurons.

Q&A

What is the molecular structure of Drosophila melanogaster Gr58a?

Gr58a (UniProt ID: P58962) is a putative gustatory receptor protein in Drosophila melanogaster. The full amino acid sequence consists of 395 amino acids with multiple transmembrane domains characteristic of chemosensory receptors. The protein contains regions with hydrophobic amino acid clusters that likely form transmembrane domains, consistent with its predicted function as a membrane-spanning receptor . Like other gustatory receptors in Drosophila, Gr58a likely adopts a topology similar to other members of the Gr family, though specific structural determinations through crystallography remain pending in current research.

What is the tissue-specific expression pattern of Gr58a in Drosophila melanogaster?

While the search results don't specifically detail Gr58a expression patterns, research on other gustatory receptors indicates that expression location significantly impacts function. For instance, Gr66a is expressed in bitter-sensing neurons in both legs and pharyngeal taste cells, with each location mediating different responses (aversion vs. attraction) . This suggests that examining Gr58a expression across different gustatory organs (labellum, tarsal segments, pharynx, internal organs) would be crucial for understanding its functional role. Immunohistochemistry using antibodies against Gr58a or using Gr58a-GAL4 driver lines paired with fluorescent reporters would be the recommended methodology to map expression patterns.

What are the optimal conditions for producing recombinant Gr58a protein for structural and functional studies?

Recombinant Gr58a protein can be produced using expression systems such as bacterial (E. coli), insect cell (Sf9, S2), or mammalian cell culture systems. Based on information about similar membrane proteins, insect cell systems may provide advantages for proper folding and post-translational modifications. When expressing Gr58a, consider using:

  • A Tris-based buffer with 50% glycerol for storage stability

  • Expression tags that facilitate purification while minimizing interference with protein function

  • Storage at -20°C or -80°C for extended periods, with working aliquots kept at 4°C for up to one week

  • Avoiding repeated freeze-thaw cycles that can compromise protein integrity

The choice between full-length protein (1-395 amino acids) or specific domains should be guided by the specific research questions being addressed.

How can electrophysiological recording techniques be optimized for measuring Gr58a-mediated responses?

For electrophysiological characterization of Gr58a function:

  • Tip recordings from gustatory sensilla expressing Gr58a are recommended for direct sensory neuron response measurement

  • Whole-cell patch clamp recordings from S2 cells expressing Gr58a (potentially co-expressed with other Grs) can elucidate channel properties, similar to methods used for L-canavanine receptor studies

  • Consider calcium imaging as a complementary approach to visualize activation patterns across multiple neurons

Studies on other gustatory receptors have shown that co-expression of multiple Grs in S2 cells can induce ligand-activated nonselective cation conductance . When designing experiments, it's crucial to consider that Gr58a may require co-expression with other receptors to form functional channels.

What behavioral assays are most effective for evaluating Gr58a function in Drosophila?

To assess Gr58a-mediated behaviors, consider implementing:

  • Two-choice preference assays that simultaneously measure positional and egg-laying preferences, as used to study Gr66a responses to lobeline

  • Proboscis extension reflex (PER) assays to evaluate acceptance or rejection behaviors

  • Capillary feeding (CAFE) assays to quantify consumption over extended periods

  • Multi-chamber positional preference assays tracking fly movement

Critically, behavioral interpretation should account for context-dependent responses. Research has shown that the same gustatory receptor (Gr66a) can mediate both aversive positional responses and attractive egg-laying behaviors depending on which gustatory organs are activated . Therefore, assays should be designed to differentiate between these potentially opposing behaviors.

How does Gr58a interact with downstream signaling components to mediate behavioral responses?

While specific Gr58a signaling pathways remain to be fully characterized, research on related gustatory receptors suggests several key experimental approaches:

  • Examine whether Gr58a functions as an ionotropic receptor (like the L-canavanine receptor complex) or couples to G-protein signaling pathways

  • Investigate potential interactions with TRP channels, as TRPA1 and TRPL have been implicated in the sensation of deterrent compounds in Drosophila

  • Use calcium imaging in both sensory neurons and their projection targets to map signal propagation

  • Employ RNAi knockdown of candidate downstream signaling components to identify functional partners

The experimental design should account for tissue-specific differences in signaling pathways, as different gustatory organs may employ distinct mechanisms to transduce Gr58a activation.

What is the role of Gr58a in the central integration of gustatory information in Drosophila?

Gustatory information processing involves central integration of signals from diverse sensory inputs. When investigating Gr58a's role in this process:

  • Map the projection patterns of Gr58a-expressing neurons to the subesophageal ganglion (SOG), as different regions of the SOG receive inputs from distinct gustatory organs

  • Examine potential connections to the mushroom body, which has been implicated in sensory integration and decision-making during oviposition behaviors

  • Use functional connectivity analyses (e.g., GRASP technique) to identify synaptic partners of Gr58a neurons

  • Implement optogenetic or thermogenetic activation of specific Gr58a neuron subsets to determine their sufficiency in driving behavior

The mushroom body may be particularly important for integrating competing signals, as it has been shown to play a crucial role in both positional aversion and egg-laying attraction behaviors .

How do developmental factors influence the establishment of Gr58a-expressing neural circuits?

Investigating the developmental trajectory of Gr58a-expressing neurons requires:

  • Temporal expression analysis using Gr58a-GAL4 drivers with fluorescent reporters across developmental stages

  • Lineage tracing to determine the origin of Gr58a neurons during development

  • Investigation of transcription factors and signaling pathways that regulate Gr58a expression

  • Examination of axon guidance and target selection mechanisms that establish connections between Gr58a neurons and central targets

Understanding developmental aspects is crucial since the proper wiring of gustatory circuits is essential for appropriate behavioral responses to tastants.

How should researchers address variability in electrophysiological responses when characterizing Gr58a function?

When analyzing electrophysiological data for Gr58a:

  • Implement robust statistical approaches that account for both biological and technical variability

  • Consider normalization methods that control for differences in receptor expression levels

  • Design data tables that clearly organize experimental variables, including tastant concentrations, recording conditions, and genetic backgrounds

  • Account for potential interactions between Gr58a and other co-expressed receptors

The analysis should quantify multiple response parameters, including response latency, amplitude, duration, and adaptation properties, which may provide insights into receptor kinetics and sensitivity.

What strategies can researchers use to differentiate between direct and indirect effects when manipulating Gr58a expression?

To distinguish direct effects of Gr58a from indirect or compensatory effects:

  • Use acute conditional manipulation techniques (e.g., temperature-sensitive Gal80) rather than constitutive genetic manipulations

  • Implement rescue experiments where Gr58a is selectively restored in specific subsets of cells in a Gr58a mutant background

  • Combine physiological recordings with behavioral assays to establish causal relationships

  • Create mosaic animals where Gr58a function is manipulated in defined subsets of neurons

This approach has proven effective in studies of Gr66a, where tissue-specific rescue experiments distinguished the roles of leg versus pharyngeal gustatory neurons in mediating different behavioral responses to lobeline .

How can researchers integrate contradictory findings regarding Gr58a function across different experimental paradigms?

When addressing seemingly contradictory results:

  • Systematically analyze differences in experimental conditions, including fly strain backgrounds, tastant preparations, and behavioral contexts

  • Consider that the same receptor may mediate different responses depending on where it is expressed, as demonstrated for Gr66a

  • Examine potential interactions with other sensory modalities, recognizing that behavioral outputs often integrate multiple sensory inputs

  • Develop unified models that incorporate context-dependent effects of Gr58a activation

Research on Gr66a demonstrates that contradictory findings may reflect biologically meaningful phenomena rather than experimental artifacts, as the same receptor can truly mediate opposing responses depending on anatomical context .

What can evolutionary analysis of Gr58a across Drosophila species reveal about its functional significance?

Evolutionary analysis approaches could include:

  • Comparative sequence analysis of Gr58a orthologs across Drosophila species to identify conserved domains

  • Correlating sequence conservation with ecological niches and feeding preferences of different Drosophila species

  • Examining whether Gr58a shows signatures of positive selection, which might indicate adaptation to specific ecological challenges

  • Functional testing of Gr58a orthologs from different species to identify potential diversification of ligand specificity

This evolutionary perspective can provide insights into whether Gr58a serves a conserved sensory function or has diversified to accommodate species-specific ecological adaptations.

How do co-expressed gustatory receptors modulate Gr58a function?

Based on findings that gustatory receptors often function in heteromeric complexes:

  • Identify gustatory receptors co-expressed with Gr58a using single-cell transcriptomics

  • Test candidate receptor combinations using heterologous expression systems to identify functional partners

  • Implement genetic interaction studies where Gr58a and candidate partners are simultaneously manipulated

  • Examine whether different receptor combinations confer distinct ligand specificities

Research has demonstrated that three gustatory receptors (GR8a, GR66a, and GR98b) collaborate to form a functional L-canavanine receptor . Similar multisubunit composition may be required for Gr58a function, potentially explaining why individual receptor manipulations sometimes yield subtle phenotypes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.